KEGG   Chlamydia pneumoniae TW183: CpB0315Help
Entry
CpB0315           CDS       T00136                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cpt  Chlamydia pneumoniae TW183
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CpB0315
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpB0315
   00020 Citrate cycle (TCA cycle)
    CpB0315
   00620 Pyruvate metabolism
    CpB0315
Enzymes [BR:cpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CpB0315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
342559..343848
Genome map
AA seq 429 aa AA seqDB search
MISLLKMPKLSPTMEVGTIVKWHKKSNDQVSFGDVIVEISTDKAILEHTANEDGWIREIL
RHEGEKIVIGTPIAVLSTEANEPFNLEELLPKTEPSNLEASPKGSSEEVSPATTPQAASA
TFTAVTFKPEPPLSSPLVFKHVGTTNNLSPLARQLAKEKNIDVSSIQGSGPGGRIVKKDL
EKAPPKSIAGFGYPESPEVPPGSYHEENLSPIREVIAARLQAAKISIPHFYVRQQVYASP
LLNLLKELQAQGIKLSINDCIVRACALALKEFPSINSGFNSVDNKIVRFDTIDISIAVAI
PDGIITPIIRCADRKNLGMISAEIKSLALKARNQSLQDTEYKGGSFCVSNLGMTGITEFT
AIVNPPQAAILAVGSVTEQALVLDGEITIGSTCNLTLSVDHRVIDGYPAAMFMKRLQKIL
EAPAVLLLN
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtgatctccttattgaaaatgccaaagctttctccaactatggaagtgggcactatagtg
aaatggcataaaaaaagtaatgatcaggtcagttttggagacgtcattgtagagatctct
acagacaaagctattttagaacatacagcaaatgaagatggctggattcgtgaaatctta
cgtcatgaaggcgagaaaatcgttataggcacccctattgcggtactctctacagaagcc
aacgagccctttaatctagaagaacttcttcctaagacagaaccttctaaccttgaagca
tctccaaaaggttcttctgaagaggtctcgcctgcaacaactccacaagctgcctcagca
acattcacagcagtaacttttaagccagagccacctctctcctcgcctttagtcttcaaa
cacgtaggcactacgaataatctctctccattagctagacaactagcaaaagagaaaaac
atagatgtctcatcaattcaagggagtggtcctggaggacgtatagtaaaaaaagattta
gagaaagctcctcctaaaagcattgctggttttggctatcctgagtctcccgaagtgcct
ccaggttcctatcatgaggagaatctctctccgattcgggaagtgattgctgcacgccta
caagctgctaagatctctattcctcacttctatgtaaggcagcaggtctacgcctcacct
ctccttaatctgctcaaagaacttcaagctcagggaatcaaactctctattaacgattgc
attgtacgtgcctgtgctctggcgctcaaagagttcccttctatcaattcaggatttaac
agtgtcgataataaaatcgtccgttttgatactatcgatatctcgatagctgtggccatt
ccagatggaattattacgccaattatacgctgcgcagaccgtaaaaatctcggcatgatt
tcagcagaaattaagagcttagcgttaaaagcaagaaatcaatctcttcaagacactgaa
tacaaaggagggtccttctgtgtctctaacttaggaatgacaggaatcactgaatttaca
gcgattgtcaatcctcctcaagcggcgattcttgccgtaggaagtgttacagaacaagct
cttgttcttgacggagaaattactataggatctacctgcaatcttaccctatctgtagat
catagagtgattgatggttatcctgctgcgatgtttatgaaacgattacaaaagatctta
gaagctccggctgtcctactattaaactag

  All links  
No link information was found.   
DBGET integrated database retrieval system