KEGG   Chlamydia pneumoniae TW183: CpB0494Help
Entry
CpB0494           CDS       T00136                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cpt  Chlamydia pneumoniae TW183
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cpt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CpB0494
Enzymes [BR:cpt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CpB0494
Exosome [BR:cpt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CpB0494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(549003..551165)
Genome map
AA seq 720 aa AA seqDB search
MVDKLIHPWDLDLLVSGRQKDPHKLLGILASEDSSDHIVIFRPGAHTVAIELLGELHHAV
AYRSGLFFLSVPKGIGHGDYRVYHQNGLLAHDPYAFPPLWGEIDSFLFHRGTHYRIYERM
GAIPMEVQGISGVLFVLWAPHAQRVSVVGDFNFWHGLVNPLRKISDQGIWELFVPGLGEG
IRYKWEIVTQSGNVIVKTDPYGKSFDPPPQGTARVADSESYSWSDHRWMERRSKQSEGPV
TIYEVHLGSWQWQEGRPLSYSEMAHRLASYCKEMHYTHVELLPITEHPLNESWGYQVTGY
YAPTSRYGTLQEFQYFVDYLHKENIGIILDWVPGHFPVDAFALASFDGEPLYEYTGHSQA
LHPHWNTFTFDYSRHEVTNFLLGSALFWLDKMHIDGLRVDAVASMLYRDYGREDGEWTPN
IYGGKENLESIEFLKHLNSVIHKEFSGVLTFAEESTAFPGVTKDVDQGGLGFDYKWNLGW
MHDTFHYFMKDPMYRKYHQKDLTFSLWYAFQESFILPLSHDEVVHGKGSLVNKLPGDTWT
RFAQMRVLLSYQICLPGKKLLFMGGEFGQYGEWSPDRPLDWELLNHHYHKTLRNCVSALN
ALYIHQPYLWMQESSQECFHWVDFHDIENNVIAYYRFAGSNRSSALLCVHHFSASTFPSY
VLRCEGVKHCELLLNTDDESFGGSGKGNRAPVVCQDQGVAWGLDIELPPLATVIYLVTFF
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggttgataaactgatccatccttgggatcttgatctgctcgtctcaggacgacagaaa
gatccccataaactcttagggatccttgcttctgaagattcttcagatcatattgttatt
tttcgtccaggggcgcatacggttgctattgaacttctaggagagcttcaccacgctgta
gcttatcgttcggggctctttttcttatccgttcccaaaggaatcggacacggggattac
cgtgtgtatcatcagaatggacttctcgctcatgatccctatgcgtttcctcctctgtgg
ggagaaattgattcttttttattccatagaggaacgcattaccgcatttatgaacgcatg
ggggcaatccctatggaagttcaaggaatctcaggggtgctctttgttctttgggctccc
catgcgcagagagtctctgtagtcggagattttaatttttggcatggccttgtcaatcct
ctacgtaaaatttccgatcaggggatctgggagcttttcgtcccaggcttgggagaggga
atacggtataagtgggaaatcgttacccaatcggggaatgtgattgtaaaaacagatcct
tatgggaagagctttgatcctccaccccagggtacagctcgtgttgcggattctgagagc
tactcttggagtgatcatcgttggatggagaggcgctcgaagcagagtgaagggcccgtc
acgatctatgaagtgcacttaggctcttggcaatggcaggagggaaggcccttaagctac
agcgaaatggcgcatcgccttgctagctattgcaaggaaatgcactacactcatgtggag
cttcttcccattacggagcatcccctgaatgaatcttggggctatcaagtgacgggatat
tatgctccaacatcaagatacgggactctccaggagtttcagtattttgtagactatcta
cataaagaaaatattggtattattttagattgggtgccgggacattttcccgtagatgcg
tttgctcttgcctcttttgatggggagcctctctacgagtacacggggcatagtcaggct
cttcatccccactggaatacgtttacctttgactacagtcgtcatgaagtgaccaacttt
ttactagggagtgctttattttggctcgataagatgcatattgatggcttacgtgtggat
gctgtggcctctatgctgtatcgtgattatggccgtgaagatggagaatggacgcctaac
atctatggaggtaaggagaacttagagtctatagaatttttgaaacacttaaattctgta
attcataaggagttctctggagtgctcacctttgcagaggaatccacagcgtttccagga
gtcactaaggacgtagatcagggaggtctggggtttgattacaaatggaacttaggttgg
atgcacgatacctttcattactttatgaaggatcccatgtatcgtaaataccatcagaaa
gatctgacatttagcctttggtatgccttccaagagtcttttattcttcctctctcgcat
gacgaggtggtccacggtaagggcagcttagtgaataagcttcccggggatacctggacc
cgatttgctcaaatgagagtgctcttgagctaccagatctgtttgcctgggaaaaagtta
ctgttcatgggtggggaattcggacaatacggcgagtggtctcctgatcgtcccttagat
tgggagcttttgaatcatcactaccacaaaactttgcgaaactgtgtctctgcattgaat
gcgttgtatattcaccaaccctatttatggatgcaagagagctctcaagagtgcttccat
tgggtagacttccatgatatagaaaacaatgtcattgcctattatagatttgcaggcagc
aatcgttcttcggcgcttctctgtgtccatcatttcagtgcgagtacttttccttcctat
gttttaaggtgtgaaggtgtaaagcattgtgaactccttctcaacactgatgatgagtct
tttggaggctcagggaagggaaatcgggctcctgtggtctgtcaagaccaaggggtcgct
tggggtttggatatagagctccctcctttagctactgtgatctatttagttacttttttc
taa

DBGET integrated database retrieval system