KEGG   Chlamydia pneumoniae TW183: CpB0543Help
Entry
CpB0543           CDS       T00136                                 

Definition
(GenBank) hypothetical protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cpt  Chlamydia pneumoniae TW183
Pathway
cpt00860  Porphyrin and chlorophyll metabolism
cpt01100  Metabolic pathways
cpt01110  Biosynthesis of secondary metabolites
cpt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CpB0543
Enzymes [BR:cpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CpB0543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AAP98472
Position
601309..601980
Genome map
AA seq 223 aa AA seqDB search
MTLYLGLNQKTARKYQAHYLPILTLFPYAKSTPQNKRALQFLPQATHVILTSPSSTHLFL
SRMTSLLSKATLKTKTYLCIGESTKERLLSFLGQVKYVVATQEIAEGIFPLLQALPSSAR
ILYPHSSLARPVIREFLYNRFTFFSYPHYTVKPRKLKKNILSKYKKIILTSPSTVRAFAK
IFPRFPEKTYWCQGRMTLQEFQKFSSQKQVSLLETLGKSRTSP
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaccctctacttaggattgaatcaaaaaaccgctcgtaaataccaagctcattatttg
cctattctaactctcttcccctatgcaaaaagcactccacaaaataagcgtgctcttcaa
ttccttccacaagcaacccatgtgattctcacaagtccctcatccactcacctattcctt
tccagaatgacttctcttctttctaaggccactctaaaaacaaagacctacctctgtata
ggagagtccaccaaagaaagacttctctctttccttggacaagtgaagtacgtagtagca
actcaagaaatcgctgaaggcatcttcccattgctacaggcactgccctcttcagcccgc
attctctacccccactcctccctcgcaagacctgtgatcagagaatttctttacaatcga
tttacttttttctcttaccctcactacacagtgaagccgcgaaaacttaaaaaaaatatt
ttatctaaatacaaaaaaattatcctcacaagcccttcaactgtaagagctttcgccaaa
atctttccgcgatttcctgaaaaaacctactggtgccaaggaaggatgaccttgcaggag
tttcaaaagttctcctctcaaaagcaggtatctttgttagaaacgcttgggaagtccagg
acatctccgtga

DBGET integrated database retrieval system