KEGG   Chlamydia pneumoniae TW183: CpB0772Help
Entry
CpB0772           CDS       T00136                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cpt  Chlamydia pneumoniae TW183
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CpB0772
Enzymes [BR:cpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CpB0772
Exosome [BR:cpt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CpB0772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(837692..838690)
Genome map
AA seq 332 aa AA seqDB search
MSSLTLSRRPRRNRKTAAIRDLLAETHLSPKDLIAPFFVKYGNNIKEEIPSLPGVFRWSL
DLLLKEIERLCTYGLRAVMLFPIIPDDLKDAYGSYSSNPKNILCHSIHEIKNAFPHLCLI
SDIALDPYTTHGHDGIFLNGEVLNDESVRIFGNIATLHAEMGADIVAPSDMMDGRIGYIR
SKLDQSGYSKTSIMSYSVKYASCLYSPFRDALSSHVTSGDKKQYQMNPKNVLEALLESSL
DEEEGADILMVKPAGLYLDVIYRIRQNTCLPLAAYQVSGEYAMILSAFQQGWLDKETLFH
ESLIAIKRAGADMIISYSAPFILELLHQGFEF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagttctttaacactaagtagacgtcctagaagaaaccgaaagacagcagctataaga
gatttgttggccgaaactcacttaagcccaaaagatctcatagcaccattctttgtgaag
tatggaaataacataaaggaagagatcccgagtcttcctggagtgttccgatggagtttg
gatttgctattaaaggaaatagagcgtttgtgtacctacgggttacgagctgtaatgctg
tttcccattattcctgatgatcttaaagatgcttacggttcttactcctcaaatcctaaa
aacatcttatgtcatagcattcatgaaataaaaaacgcatttcctcacctatgtctgatt
agtgatatagctttagatccttatacgacacacggtcatgatgggattttccttaatgga
gaggtccttaatgatgaaagtgttagaatttttggaaatattgcaactttacatgctgaa
atgggagcggatatcgtagctccgagtgatatgatggatggaaggattggctacattcgc
tctaagttagaccagtctggctactcaaagacctctataatgtcttatagtgtaaagtac
gcttcttgtttgtattctccttttcgtgatgcgctgagttctcacgtaacttcaggagat
aaaaaacagtatcagatgaaccctaaaaacgtattagaggcattgcttgaatcttcttta
gacgaggaggagggagcagatatcttaatggtgaagcctgcaggactctatcttgatgtg
atctatcggattcgacaaaatacctgtttgcctctagctgcgtatcaggtcagtggggaa
tacgctatgatcttatcagcctttcaacaaggttggttagataaagaaacactatttcat
gagtctttgatagcaatcaagagagctggcgcagatatgattattagttactccgctcct
tttattttggaattactgcatcagggatttgaattttaa

DBGET integrated database retrieval system