KEGG   Chlamydia pneumoniae TW183: CpB0786Help
Entry
CpB0786           CDS       T00136                                 

Definition
dihydropteroate synthase
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
cpt  Chlamydia pneumoniae TW183
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CpB0786
Enzymes [BR:cpt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CpB0786
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CpB0786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
852432..853784
Genome map
AA seq 450 aa AA seqDB search
MSEPRFVCLSLGSNLGNRFKNLQIARTLLGEQAVLGLRSSVILETEALLLPGSPPEWDLP
YFNSVLVGETTLSLRELLVTIKQIEKVVGRAEESPPWSPRTIDVDILLYGDESFCCDHTE
ITIPLSNLLSRPFLIALIASLCPYRRFCTQGSPYHNFTFGELAHHLPSPPGMIRRSLSPD
TMLMGVVNVTNDSMSDGGMFLDPEKAVAQAEKLFTEGAAVIDFGAQATNPKVKQFLSVDQ
EWERLEPVLRLLKETWSNRKQYPIISLDTFYPEIILRAMDIYPIQWINDVSGGSQSMAEV
ARDCELSLVMNHSSSLPVDPKNILSFSVPIGEQLLSWGEKQLKMFSDVGLNANQVIFDPG
IGFGKGAAQSLATLYEIAKFKRLGCPILIGHSRKSFLSLFGNHDPKDRDWETVGLSILLQ
QQGVDYLRVHNVAAHQKALSVAACEACAPI
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagccccgttttgtctgcttaagtttaggatcaaatttaggaaatcgttttaaa
aatctacagattgctcgtactttattaggcgaacaagctgttttaggtctacgtagttcg
gtaattctagaaacagaagccttgttattaccgggatctcctccagagtgggaccttcct
tattttaattcggtacttgtaggggaaaccaccctatctttgcgagaactactggttact
atcaaacagatagagaaggtggtaggtagagcagaggagtcgcccccatggtctcctcga
accatagatgtagatattttgctttatggtgacgagtctttttgttgtgatcacaccgag
ataacgattcctttgtccaatttgttatcacgtccttttttgattgctttaatagcatct
ctttgtccttatcgtcgattttgcactcaaggttctccttatcacaactttacatttgga
gagttggcgcatcaccttccctcacctccagggatgattcgtaggagtttatctccagat
acgatgttgatgggggtggtaaatgtgactaacgactctatgtctgatgggggcatgttt
ttagatccagaaaaagcagtggctcaagctgagaagttatttacagagggcgctgcagtt
atagattttggagctcaagcaacaaaccctaaagtaaagcagtttttatctgtagatcaa
gaatgggagcgtctggagcctgttttaaggttgttaaaagagacttggtccaatagaaaa
caatatccaatcatctctttagatacgttttatcctgaaattattcttagggctatggat
atttatccgatccagtggattaatgatgtctctgggggatcacagtctatggctgaggtc
gctagggattgtgagctatccttggttatgaatcactcgtcttcgcttcctgtggatcct
aaaaatatcttgtcgttttctgtccctattggagagcaactgttgagctggggtgagaag
caacttaagatgttttctgatgttggtctgaacgcaaatcaggtgatttttgatcccggt
ataggttttgggaagggggctgcgcaatctttggctactttgtatgagattgcgaaattt
aagcgtttgggatgccctatccttattggacattctcgaaaatcgttcttatctttattt
ggtaatcatgatcccaaggatcgtgattgggaaaccgtaggtctatctatactcttacaa
caacaaggtgtggactacttgcgagtgcataatgttgctgctcatcaaaaagctttatca
gtagctgcttgtgaagcctgtgcacccatctaa

DBGET integrated database retrieval system