KEGG   Chlamydia pneumoniae TW183: CpB0786Help
Entry
CpB0786           CDS       T00136                                 

Definition
dihydropteroate synthase
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
cpt  Chlamydia pneumoniae TW183
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cpt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
852432..853784
Genome map
AA seq 450 aa AA seqDB search
MSEPRFVCLSLGSNLGNRFKNLQIARTLLGEQAVLGLRSSVILETEALLLPGSPPEWDLP
YFNSVLVGETTLSLRELLVTIKQIEKVVGRAEESPPWSPRTIDVDILLYGDESFCCDHTE
ITIPLSNLLSRPFLIALIASLCPYRRFCTQGSPYHNFTFGELAHHLPSPPGMIRRSLSPD
TMLMGVVNVTNDSMSDGGMFLDPEKAVAQAEKLFTEGAAVIDFGAQATNPKVKQFLSVDQ
EWERLEPVLRLLKETWSNRKQYPIISLDTFYPEIILRAMDIYPIQWINDVSGGSQSMAEV
ARDCELSLVMNHSSSLPVDPKNILSFSVPIGEQLLSWGEKQLKMFSDVGLNANQVIFDPG
IGFGKGAAQSLATLYEIAKFKRLGCPILIGHSRKSFLSLFGNHDPKDRDWETVGLSILLQ
QQGVDYLRVHNVAAHQKALSVAACEACAPI
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagccccgttttgtctgcttaagtttaggatcaaatttaggaaatcgttttaaa
aatctacagattgctcgtactttattaggcgaacaagctgttttaggtctacgtagttcg
gtaattctagaaacagaagccttgttattaccgggatctcctccagagtgggaccttcct
tattttaattcggtacttgtaggggaaaccaccctatctttgcgagaactactggttact
atcaaacagatagagaaggtggtaggtagagcagaggagtcgcccccatggtctcctcga
accatagatgtagatattttgctttatggtgacgagtctttttgttgtgatcacaccgag
ataacgattcctttgtccaatttgttatcacgtccttttttgattgctttaatagcatct
ctttgtccttatcgtcgattttgcactcaaggttctccttatcacaactttacatttgga
gagttggcgcatcaccttccctcacctccagggatgattcgtaggagtttatctccagat
acgatgttgatgggggtggtaaatgtgactaacgactctatgtctgatgggggcatgttt
ttagatccagaaaaagcagtggctcaagctgagaagttatttacagagggcgctgcagtt
atagattttggagctcaagcaacaaaccctaaagtaaagcagtttttatctgtagatcaa
gaatgggagcgtctggagcctgttttaaggttgttaaaagagacttggtccaatagaaaa
caatatccaatcatctctttagatacgttttatcctgaaattattcttagggctatggat
atttatccgatccagtggattaatgatgtctctgggggatcacagtctatggctgaggtc
gctagggattgtgagctatccttggttatgaatcactcgtcttcgcttcctgtggatcct
aaaaatatcttgtcgttttctgtccctattggagagcaactgttgagctggggtgagaag
caacttaagatgttttctgatgttggtctgaacgcaaatcaggtgatttttgatcccggt
ataggttttgggaagggggctgcgcaatctttggctactttgtatgagattgcgaaattt
aagcgtttgggatgccctatccttattggacattctcgaaaatcgttcttatctttattt
ggtaatcatgatcccaaggatcgtgattgggaaaccgtaggtctatctatactcttacaa
caacaaggtgtggactacttgcgagtgcataatgttgctgctcatcaaaaagctttatca
gtagctgcttgtgaagcctgtgcacccatctaa

DBGET integrated database retrieval system