KEGG   Chlamydia pneumoniae TW183: CpB0892Help
Entry
CpB0892           CDS       T00136                                 

Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cpt  Chlamydia pneumoniae TW183
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CpB0892
   01230 Biosynthesis of amino acids
    CpB0892
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpB0892
  Energy metabolism
   00680 Methane metabolism
    CpB0892
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CpB0892
Enzymes [BR:cpt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CpB0892
Exosome [BR:cpt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CpB0892
  Exosomal proteins of melanoma cells
   CpB0892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(978151..978837)
Genome map
AA seq 228 aa AA seqDB search
MALLILLRHGQSVWNEKNLFSGWVDIPLSQQGIEEAFSAGRAIQNLPIDCIFTSTLVRSL
MTALLAMTNHHSKKIPYIVHEDPKAKEMSRIYSAEEENNMIPLYQSSALNERMYGELQGK
NKKQTAEQFGEERVKLWRRSYKTAPPQGESLYDTKQRTLPYFEKNILPQLQNGKNVFVSA
HGNSLRSLIMDLEKLSEEEVLSLELPTGKPVVYQWKNHKIEKHPEFFG
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggctcttcttattttattacgtcatggacaatctgtatggaatgaaaaaaatttattt
tctggatgggtagacattcctttaagccaacagggaattgaagaggctttttccgcagga
agagctattcaaaatttgcctatagactgcatctttacctctaccttagtacgtagtctg
atgaccgccttactcgccatgacaaatcatcactctaagaagatcccctatattgttcat
gaagatcccaaagcaaaagagatgtcgaggatctacagtgcggaagaagaaaacaatatg
attcctctctatcaatctagtgccctcaacgaaagaatgtacggcgaacttcaaggaaaa
aataaaaaacaaacagccgaacagttcggagaagagcgggtcaagctgtggaggcgcagc
tacaaaacagctcctcctcagggagaaagcctctatgatacgaaacaaaggaccttgcct
tactttgaaaaaaatattttgcctcaactgcaaaatggaaaaaacgtttttgtttctgcg
cacggaaattccttacgctctttgattatggatctagaaaaattaagtgaagaagaggta
ctatctttagaattaccgacgggaaaaccagttgtatatcaatggaaaaaccacaaaatc
gaaaagcacccagaattttttggttaa

DBGET integrated database retrieval system