KEGG   Chlamydia pneumoniae TW183: CpB0892Help
Entry
CpB0892           CDS       T00136                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cpt  Chlamydia pneumoniae TW183
Pathway
cpt00010  Glycolysis / Gluconeogenesis
cpt00260  Glycine, serine and threonine metabolism
cpt00680  Methane metabolism
cpt01100  Metabolic pathways
cpt01110  Biosynthesis of secondary metabolites
cpt01120  Microbial metabolism in diverse environments
cpt01130  Biosynthesis of antibiotics
cpt01200  Carbon metabolism
cpt01230  Biosynthesis of amino acids
Module
cpt_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpB0892
  Energy metabolism
   00680 Methane metabolism
    CpB0892
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CpB0892
Enzymes [BR:cpt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CpB0892
Membrane trafficking [BR:cpt04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CpB0892
Exosome [BR:cpt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CpB0892
  Exosomal proteins of melanoma cells
   CpB0892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AAP98821
UniProt: Q9Z743
Position
complement(978151..978837)
Genome map
AA seq 228 aa AA seqDB search
MALLILLRHGQSVWNEKNLFSGWVDIPLSQQGIEEAFSAGRAIQNLPIDCIFTSTLVRSL
MTALLAMTNHHSKKIPYIVHEDPKAKEMSRIYSAEEENNMIPLYQSSALNERMYGELQGK
NKKQTAEQFGEERVKLWRRSYKTAPPQGESLYDTKQRTLPYFEKNILPQLQNGKNVFVSA
HGNSLRSLIMDLEKLSEEEVLSLELPTGKPVVYQWKNHKIEKHPEFFG
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggctcttcttattttattacgtcatggacaatctgtatggaatgaaaaaaatttattt
tctggatgggtagacattcctttaagccaacagggaattgaagaggctttttccgcagga
agagctattcaaaatttgcctatagactgcatctttacctctaccttagtacgtagtctg
atgaccgccttactcgccatgacaaatcatcactctaagaagatcccctatattgttcat
gaagatcccaaagcaaaagagatgtcgaggatctacagtgcggaagaagaaaacaatatg
attcctctctatcaatctagtgccctcaacgaaagaatgtacggcgaacttcaaggaaaa
aataaaaaacaaacagccgaacagttcggagaagagcgggtcaagctgtggaggcgcagc
tacaaaacagctcctcctcagggagaaagcctctatgatacgaaacaaaggaccttgcct
tactttgaaaaaaatattttgcctcaactgcaaaatggaaaaaacgtttttgtttctgcg
cacggaaattccttacgctctttgattatggatctagaaaaattaagtgaagaagaggta
ctatctttagaattaccgacgggaaaaccagttgtatatcaatggaaaaaccacaaaatc
gaaaagcacccagaattttttggttaa

DBGET integrated database retrieval system