KEGG   Chlamydia pneumoniae TW183: CpB0952Help
Entry
CpB0952           CDS       T00136                                 

Definition
bisphosphonucleoside 3(2')-phosphohydrolase-like protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cpt  Chlamydia pneumoniae TW183
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cpt00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1047778..1048755)
Genome map
AA seq 325 aa AA seqDB search
MHSELPNYQNIVESVVTEITTQLLNYRSEHRLVPFWEKSDGSFITAADYGSQYYLKQQLA
KAFPNIPFIGEETLYPDQDNEKIPEILKFTRLLTSSVSRDDLISTLVPPPSPTSLFWLVD
PIDGTAGFIRHRAFAVAISLIYEYRPILSVMACPAYNQTFKLYSAAKGHGLSIVHSQNLD
RRFVYADRKQTKQFCEASLAALNQQHHATRKLSLGLPNTPSPRRVESQYKYALVAEGAVD
FFIRYPFIDSPARAWDHVPGAFLVEEAGGRVTDALGAPLEYRKESLVLNNHAVILASGDQ
ETHETTLAALQNQLNVVPTDKLIAL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcactccgagttgcctaactatcagaacatcgttgagtctgtagttacggaaatcact
acacaactactaaactatcgaagcgagcaccgtttggttcctttttgggaaaaatccgat
ggttcttttatcaccgctgctgattacggcagtcaatattatctaaaacaacagcttgca
aaagcctttcccaatattccttttattggagaagaaactctatatcctgatcaagacaac
gaaaaaatccctgaaatcttaaaatttacacgcctgttaacttcttcagtctcaagagat
gacttaatttctaccctggtccctcctccatctccgacttctttattttggcttgtcgac
cctattgatggtactgcaggttttatcagacatcgtgcttttgccgttgctatatcacta
atttatgagtatcgaccgattttgtcggtcatggcatgccctgcctataatcagacattt
aaactatattcagcagctaaaggtcatggtctttctattgttcattctcaaaatctagat
agacgctttgtttatgctgatagaaaacaaacaaaacaattctgtgaggcttcgttagct
gcattgaatcaacagcatcatgcaacacgtaagctaagcctgggtctccccaacactccg
agtcctcgtcgtgtagaaagccaatataagtatgctttagttgctgaaggcgccgtagat
tttttcattcgctacccttttattgattctcccgctcgtgcttgggatcacgtacctgga
gccttcctcgttgaagaagctgggggtagagtcacggatgctttaggagcccctttagaa
tatagaaaagaaagtttggtcttaaataatcacgcagtgattcttgcttctggagaccag
gaaacccatgagacaacattagcagcgttacaaaaccaactcaatgttgtccccacggat
aagcttattgctctatga

DBGET integrated database retrieval system