KEGG   Chlamydia pneumoniae TW183: CpB0958Help
Entry
CpB0958           CDS       T00136                                 

Definition
thioredoxin disulfide isomerase
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
cpt  Chlamydia pneumoniae TW183
Brite
Enzymes [BR:cpt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CpB0958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1055410..1055910
Genome map
AA seq 166 aa AA seqDB search
MKFWLQGCAFVGCLLLTLPCCAARRRASGENLQQTRPIAAANLQWESYAEALEHSKQDHK
PICLFFTGSDWCMWCIKMQDQILQSSEFKHFAGVHLHMVEVDFPQKNHQPEEQRQKNQEL
KAQYKVTGFPELVFIDAEGKQLARMGFEPGGGAAYVSKVKSALKLR
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttggttgcaaggatgtgcttttgtcggttgtctgctattgactttaccttgt
tgtgctgcacgaagacgtgcttctggagaaaatttgcaacaaactcgtcctatagcagct
gcaaatctacaatgggagagctatgcagaagctcttgaacattctaaacaagatcacaaa
cctatttgtcttttctttacaggatcagactggtgtatgtggtgcataaaaatgcaagac
cagattttgcaaagctctgagtttaagcattttgcgggtgtgcatctgcatatggttgaa
gttgatttcccccaaaagaatcatcaacctgaagagcagcgccaaaaaaatcaagaactg
aaagctcaatataaagttacaggattccccgaactggtcttcatagatgcagaaggaaaa
cagcttgctcgcatgggatttgagcctggtggtggagctgcttacgtaagcaaggtgaag
tctgctcttaaactacgttaa

DBGET integrated database retrieval system