KEGG   Chlamydia pneumoniae TW183: CpB0992Help
Entry
CpB0992           CDS       T00136                                 

Definition
kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cpt  Chlamydia pneumoniae TW183
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cpt00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1086004..1086528
Genome map
AA seq 174 aa AA seqDB search
MGSRNRKRCSFFFSSGTALGKGRGEHLFSIKKLNHKHKYVLYLDHQGIPTEKAYQSLLPQ
DYSTGNHNACFYGENDLEKSVFRIRTDLKNKKHMLERMWSPFESHVLMSGSGATLFVCYL
EELEQDSKVSSQIHSLIKQTQGIPVSRLYREPHWYSLKQSTYKNSPLECFQPQI
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
ttgggctcgagaaatcggaagcgatgttccttttttttttcttcaggaacagcattaggg
aaaggtcggggagaacacctcttctctataaaaaaactcaaccataaacataaatatgtt
ctctatctcgatcatcaaggaatacccacagaaaaggcataccaatccttacttccacaa
gactatagtacaggaaatcataacgcctgtttctatggtgaaaatgatctagaaaaatcc
gtatttcgtatacggacagacttgaaaaataaaaaacacatgttagagaggatgtggagt
cctttcgaaagccatgtgcttatgtcaggttcaggagctaccctattcgtttgttatcta
gaagagttagaacaagattcaaaagtatcctcccaaatccatagcctaatcaaacaaacc
caaggaattcccgttagccgtctttatagggaaccgcattggtattctctaaagcaatct
acttacaaaaacagcccgctagagtgttttcagccacagatatga

DBGET integrated database retrieval system