KEGG   Chlamydia pneumoniae TW183: CpB0992Help
Entry
CpB0992           CDS       T00136                                 

Definition
kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cpt  Chlamydia pneumoniae TW183
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CpB0992
Enzymes [BR:cpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CpB0992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1086004..1086528
Genome map
AA seq 174 aa AA seqDB search
MGSRNRKRCSFFFSSGTALGKGRGEHLFSIKKLNHKHKYVLYLDHQGIPTEKAYQSLLPQ
DYSTGNHNACFYGENDLEKSVFRIRTDLKNKKHMLERMWSPFESHVLMSGSGATLFVCYL
EELEQDSKVSSQIHSLIKQTQGIPVSRLYREPHWYSLKQSTYKNSPLECFQPQI
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
ttgggctcgagaaatcggaagcgatgttccttttttttttcttcaggaacagcattaggg
aaaggtcggggagaacacctcttctctataaaaaaactcaaccataaacataaatatgtt
ctctatctcgatcatcaaggaatacccacagaaaaggcataccaatccttacttccacaa
gactatagtacaggaaatcataacgcctgtttctatggtgaaaatgatctagaaaaatcc
gtatttcgtatacggacagacttgaaaaataaaaaacacatgttagagaggatgtggagt
cctttcgaaagccatgtgcttatgtcaggttcaggagctaccctattcgtttgttatcta
gaagagttagaacaagattcaaaagtatcctcccaaatccatagcctaatcaaacaaacc
caaggaattcccgttagccgtctttatagggaaccgcattggtattctctaaagcaatct
acttacaaaaacagcccgctagagtgttttcagccacagatatga

DBGET integrated database retrieval system