KEGG   Corynebacterium pseudotuberculosis FRC41: cpfrc_00233Help
Entry
cpfrc_00233       CDS       T01277                                 

Gene name
rmlC
Definition
dTDP-4-dehydrorhamnose reductase (EC:1.1.1.133)
Orthology
K00067  
dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cpu  Corynebacterium pseudotuberculosis FRC41
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    cpfrc_00233 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    cpfrc_00233 (rmlC)
Enzymes [BR:cpu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.133  dTDP-4-dehydrorhamnose reductase
     cpfrc_00233 (rmlC)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     cpfrc_00233 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(245364..246746)
Genome map
AA seq 460 aa AA seqDB search
MNIETCPIQGMMVIHLDLHEDSRGWFKENWQESKLVGLGLTGFRPVQNNISFNAEAGVTR
GLHAEPWDKYVSVATGSVFGAWCDLREGSATFGATFTITITPETAVFVPRGVANGFQALE
ATAYTYLVNDHWAPDAHYSFVNLADPALNISWPIPLDQATLSKKDTAHPPLASAVPVPPK
KVLVTGANGQLGRTLKKVFPHAEFCSRTDLDITTDITEARRWADYSVIINAAAYTAVDAA
ETDSTAAWRTNAEAPARLAAIAARYGITLVHLSSDYVFDGELPVHSEQEPFSPLSVYGQS
KAAGDTAVSVAPQHYVVRTSWVVGEGNNFVSTMLSLAARRISPQVVNDQLGRLTFTEDLA
AGIRFLLDNHAPYGVYNLSNSGEIVSWAQLAQRVFTLAGRSASDVQPVSTTEYFAGKAPA
APRPRHSALDLSKITGLGFTPRDWQDALASYCTTLDAKEG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaacatagaaacctgccctatccagggcatgatggtcatccatctcgacttgcatgag
gactctcgcggctggttcaaagaaaattggcaagagtccaagcttgtcggcttaggactc
accggtttccgaccagtgcaaaacaatatttcctttaatgctgaggccggagtaacccgc
ggtttacacgcagaaccatgggataaatacgtctccgtagcaaccggctcagtctttggc
gcctggtgcgatttacgcgaagggtccgcaacgtttggcgccacatttaccatcaccatt
acccctgagaccgctgtctttgttccgcggggggtggccaacggattccaggctcttgaa
gctaccgcatacacctatttagtcaacgaccactgggcaccagacgctcattattctttt
gtcaatcttgctgatcctgcattaaacatttcttggccgatccccctcgatcaagcgacc
ctttccaagaaagacacggcgcaccctccgctagcatcagcggtacccgtaccacccaag
aaagtactggttaccggggcaaacgggcagcttggcaggactctaaaaaaggtcttcccc
catgccgagttctgctctcgcaccgacttagacatcactacagacattacagaggcgcgt
cgctgggctgactacagcgtaattatcaacgccgcggcctacacagctgtcgacgccgct
gaaactgattcaactgctgcttggcgtaccaacgcggaagctcctgctcgccttgccgcg
attgctgctcgatacgggatcacactggtgcatctctctagcgactatgtctttgacggc
gaactccctgttcacagtgaacaagaacccttcagcccgctgagcgtctatgggcagtcg
aaagctgctggcgatactgctgtaagcgttgccccacagcattatgtagtgcgcaccagc
tgggtggtgggagaagggaataactttgtatccacgatgctctcccttgccgcacgcagg
atctctccccaggtggtaaacgatcagctaggcaggctcacctttactgaggacctggcc
gcaggtatccgatttttgctcgataatcatgccccttatggggtgtataacctcagcaat
tctggggagattgtgtcctgggcgcaactagcacaacgggtatttacgctggcggggcgt
tcggcttccgacgttcaaccagtaagcacaaccgaatattttgcaggaaaagcacccgct
gccccgcgtccccgccactcagccttggacttgagtaaaatcacgggactcgggttcacc
ccacgtgattggcaggatgcactcgcgagctactgcaccacactggatgcaaaggaaggc
taa

DBGET integrated database retrieval system