KEGG   Corynebacterium pseudotuberculosis FRC41: cpfrc_00257Help
Entry
cpfrc_00257       CDS       T01277                                 

Gene name
gpmA
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cpu  Corynebacterium pseudotuberculosis FRC41
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:cpu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cpu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cpu00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:cpu00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cpu00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
274007..274753
Genome map
AA seq 248 aa AA seqDB search
MTIGKLILLRHGQSEWNASNQFTGWVDVNLTEQGEAEAKRGGEMLKQQDVLPTVVYTSLL
RRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETKDKYGADQFMEWRRSYG
TPPPELEDSSEFSQANDPRYADLSQVPRTECLKDVVERFVPYFEEEILPRAKKGETVLIA
AHGNSLRALVKHLDNISDADIAELNIPTGIPLVYELDQEGKVLNPGGTYLDPEAAAAGAA
AVAAQGGK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgactatcggaaaactgattcttctccgccacggacaaagcgagtggaacgcctccaac
cagttcacgggttgggtggacgttaaccttactgagcaaggcgaggccgaggccaagcgc
ggcggcgagatgctgaagcaacaagatgttttgccaactgttgtttatacttctcttctt
cgtcgcgcaatccgcaccgccaacatcgcactcaacgcggcggatcgtcattggatcccg
gtcgtgcgcgattggcgcctcaacgagcgtcactatggtgcgttgcagggtctgaacaag
gctgagaccaaggataagtatggcgcagatcagttcatggaatggcgccgttcttacggc
acccctcctccggagttggaagactcaagtgagttttctcaggcaaacgacccccgctac
gccgatctgtctcaggttcctcgcacggaatgcctcaaggacgttgtagaacgttttgtg
ccttattttgaagaggaaattttgccacgggcgaaaaagggcgagactgtcctcatcgca
gcgcatggtaattccttgcgtgcattggtcaaacaccttgacaatatctcggatgcagat
atcgcggagctgaatattcctaccggaattccgctggtatacgagctggaccaggaagga
aaggttcttaacccgggtggtacctaccttgatccagaggcagcggcagcaggagctgcg
gcagttgctgcgcaaggcggcaaataa

DBGET integrated database retrieval system