KEGG   Corynebacterium pseudotuberculosis FRC41: cpfrc_00257Help
Entry
cpfrc_00257       CDS       T01277                                 

Gene name
gpmA
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cpu  Corynebacterium pseudotuberculosis FRC41
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cpu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cpfrc_00257 (gpmA)
   01230 Biosynthesis of amino acids
    cpfrc_00257 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cpfrc_00257 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    cpfrc_00257 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cpfrc_00257 (gpmA)
Enzymes [BR:cpu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     cpfrc_00257 (gpmA)
Exosome [BR:cpu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   cpfrc_00257 (gpmA)
  Exosomal proteins of melanoma cells
   cpfrc_00257 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
274007..274753
Genome map
AA seq 248 aa AA seqDB search
MTIGKLILLRHGQSEWNASNQFTGWVDVNLTEQGEAEAKRGGEMLKQQDVLPTVVYTSLL
RRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETKDKYGADQFMEWRRSYG
TPPPELEDSSEFSQANDPRYADLSQVPRTECLKDVVERFVPYFEEEILPRAKKGETVLIA
AHGNSLRALVKHLDNISDADIAELNIPTGIPLVYELDQEGKVLNPGGTYLDPEAAAAGAA
AVAAQGGK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgactatcggaaaactgattcttctccgccacggacaaagcgagtggaacgcctccaac
cagttcacgggttgggtggacgttaaccttactgagcaaggcgaggccgaggccaagcgc
ggcggcgagatgctgaagcaacaagatgttttgccaactgttgtttatacttctcttctt
cgtcgcgcaatccgcaccgccaacatcgcactcaacgcggcggatcgtcattggatcccg
gtcgtgcgcgattggcgcctcaacgagcgtcactatggtgcgttgcagggtctgaacaag
gctgagaccaaggataagtatggcgcagatcagttcatggaatggcgccgttcttacggc
acccctcctccggagttggaagactcaagtgagttttctcaggcaaacgacccccgctac
gccgatctgtctcaggttcctcgcacggaatgcctcaaggacgttgtagaacgttttgtg
ccttattttgaagaggaaattttgccacgggcgaaaaagggcgagactgtcctcatcgca
gcgcatggtaattccttgcgtgcattggtcaaacaccttgacaatatctcggatgcagat
atcgcggagctgaatattcctaccggaattccgctggtatacgagctggaccaggaagga
aaggttcttaacccgggtggtacctaccttgatccagaggcagcggcagcaggagctgcg
gcagttgctgcgcaaggcggcaaataa

DBGET integrated database retrieval system