KEGG   Corynebacterium pseudotuberculosis FRC41: cpfrc_00277Help
Entry
cpfrc_00277       CDS       T01277                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cpu  Corynebacterium pseudotuberculosis FRC41
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    cpfrc_00277 (hemY)
Enzymes [BR:cpu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     cpfrc_00277 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
294575..295960
Genome map
AA seq 461 aa AA seqDB search
MRIAIIGAGLAGLTAAYEIHKLAPHADVEVFEATDRIGGKLFTVPFASGPTDMGAEAYLV
FREDTTEFFKELGLEESLRSPSGLPSLLYQGGSLHSMPSNTIMGIPGTSEDLGNLVSEET
RKRIDSEINAESIEWPQEISLGALLRERLGDDVVDHVVSTLQGGVYSSTSDDLSVRATVP
QLARALDKLKEEGKPVTITGAVQRLLSEREERNKKRGYTPSVFASFAGGYAEMYEALAER
SEAKIHIDAFITAVDKKPEGFVLKGAEGVFDKVLLTVPAPTAALLLKNLVPEAAQQLKTI
KLASSAVVGMKFDNSAGLPDNSGILVATNAQDVRAKAFTFSSKKWPHLGERGGALVRASF
GRFGEDAIARADEDELVDAALDDLQTITGFDGRAAGLSEIFVQRWFGGLPVYGPGHLDTV
AAIKKALAQVEGIDATGAWADGVGVPAVIDAAKAAAKRALA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcattgccatcatcggtgccggtttagcggggctaacggctgcttatgagattcat
aaactcgcccctcacgcggacgtagaggtgttcgaggcgacagatcgaattggcggcaaa
ctgttcacggttccgtttgcctccggtcctactgatatgggcgcagaagcatatttagtt
tttcgggaagataccactgaatttttcaaagagctaggactcgaggagagtttgcgttct
ccctcggggttgccttctttgctataccagggaggcagccttcatagcatgccttccaac
acgatcatgggtatccccggcacaagtgaggacctaggtaacctggtcagcgaggaaact
cgcaaacgcattgactcggaaataaacgcggagtctattgagtggcctcaagaaataagc
ctgggtgcactcctgcgggaacgcttgggtgatgatgttgtagatcatgtggtgtcgacg
ctgcaaggtggcgtttattcttctacctcggatgatctcagcgtgcgcgctacggtaccg
cagctagcgcgggccttagacaagctcaaagaagagggaaagcccgtaaccatcacgggt
gctgttcaacggcttttgtctgagcgagaggaacgtaacaaaaaacggggatataccccg
agcgtttttgcgtctttcgcaggcggttatgcggagatgtatgaggctcttgctgagcgt
agcgaggcaaagatccacatcgatgcctttattaccgcagtggataaaaagcctgagggt
tttgtgctcaagggtgctgaaggggtctttgataaagtcctgttgacggtgccggcgccc
acggcggctctgctgcttaagaaccttgttccggaggctgcacaacagcttaaaactatc
aagctagcgagctctgccgtggtaggaatgaagtttgataattccgcgggactccccgat
aactctgggattcttgttgccactaatgcccaagatgtgagggcaaaagcattcaccttc
tcctctaagaagtggcctcacctgggggaacgtggcggtgctttagtgcgggcctctttc
ggtaggtttggtgaggacgctatcgcgcgcgcagacgaagacgagcttgtcgacgcagcc
ctcgacgacctacagaccattacgggattcgacggacgtgctgctggattatcggagatc
tttgtccagcgatggttcggcgggttgccagtgtatggtcctgggcacttggacacggtt
gcagcaatcaagaaagcactggctcaggtcgagggcatcgatgctactggtgcgtgggcc
gatggcgtcggcgttcccgcagtgatcgatgctgcgaaagcagcggccaaacgagcactt
gcctaa

DBGET integrated database retrieval system