KEGG   Corynebacterium pseudotuberculosis FRC41: cpfrc_00612Help
Entry
cpfrc_00612       CDS       T01277                                 

Definition
(RefSeq) hypothetical protein
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cpu  Corynebacterium pseudotuberculosis FRC41
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cpu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    cpfrc_00612
  Carbohydrate metabolism
   00640 Propanoate metabolism
    cpfrc_00612
   00650 Butanoate metabolism
    cpfrc_00612
  Lipid metabolism
   00071 Fatty acid degradation
    cpfrc_00612
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    cpfrc_00612
   00310 Lysine degradation
    cpfrc_00612
   00360 Phenylalanine metabolism
    cpfrc_00612
   00380 Tryptophan metabolism
    cpfrc_00612
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    cpfrc_00612
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    cpfrc_00612
   00281 Geraniol degradation
    cpfrc_00612
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    cpfrc_00612
   00627 Aminobenzoate degradation
    cpfrc_00612
   00930 Caprolactam degradation
    cpfrc_00612
Enzymes [BR:cpu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     cpfrc_00612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
647185..647958
Genome map
AA seq 257 aa AA seqDB search
MARFKRLGIFKCSPDTCCEGEKSGRGETGLFEQTRDDDASRALKEIETVKVSSDGFVRHI
VLDRDDRRNALSGDMCRAIAHAVTEASAAAVDNASVRAIMISGVGRAFCAGADLGSSVRE
GGEHSSDGAVYGAGFHDALFAMLHSIIQAEVPIIANVQGAAVGAGMQLALACDLRVVGES
AWFKVPAVSLGFALDGWTIGRAQKLCGGAFARNLLLAGASLTPDAALSSGFAAIRGDHAA
AVAFAHEVAGLAPLSVR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggccaggtttaaaaggctaggtatttttaagtgctcgccagatacgtgctgtgaaggt
gaaaagtcgggaagaggagagacgggattgtttgaacaaactcgagacgatgatgcctcg
cgggctttgaaagagatagaaactgtcaaggtatcctccgatggttttgtgcgtcatatc
gttttggatagagatgatcgccggaacgctctttcgggtgatatgtgccgagctatcgca
cacgccgtgactgaagcttctgctgcggccgtcgataatgcatcagtgcgtgcgatcatg
attagcggagtaggacgagccttttgcgcaggtgctgatctggggtcgtctgtgcgagaa
ggtggggaacattcctcggatggggcggtgtatggcgccggtttccatgatgcgctcttt
gctatgttgcattcgattattcaggcagaggtgccgataatagctaatgtgcaaggggct
gcggtaggtgctgggatgcagcttgctttggcgtgtgatctccgtgttgttggagagtct
gcatggtttaaagtccccgctgtttctttggggtttgcgctggatggatggactataggg
cgtgctcaaaaactctgtggcggtgcttttgctaggaatttgttgcttgccggtgcatca
ttgaccccggatgcggctctgtctagtggttttgctgcaatccggggcgaccatgctgca
gcagttgcttttgctcatgaagttgccggattggcgcctctttctgtacggtag

DBGET integrated database retrieval system