KEGG   Corynebacterium pseudotuberculosis FRC41: cpfrc_00634Help
Entry
cpfrc_00634       CDS       T01277                                 

Gene name
cysQ
Definition
inositol-1-monophosphatase family protein (EC:3.1.3.25)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cpu  Corynebacterium pseudotuberculosis FRC41
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cpu00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(669438..670319)
Genome map
AA seq 293 aa AA seqDB search
MWLFPNGFSCRCKQNTMKNSQNRYADGLVVRNARAPLNFRVMTAHFDDATLTKRLAQGTG
EILKGVRNVGLLRGRELGDAGDDLAQNWIARVLEQHRPDDGFLSEEAADNPERLGKDRVW
IIDPLDGTKEFATGRQDWAVHIALVEDGTPTHAAVNLPDLGVVFHTSEVRAVRGPYAKKI
AVSHNRPPAVANHVAEKLSFTAEPLGSAGAKAMHVLLGDYDAYIHAGGQYEWDSAAPVGV
SLAAGLHCSRLDGSPLTYNNKDTYLPDLLVCRPELADDILSMVAAFREENGSY
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtggttgtttcccaatggattttcttgtcgctgtaaacaaaacacaatgaaaaactca
caaaatcgatacgctgacggtctagtagtgcgaaacgcccgtgctccattaaactttaga
gtcatgactgctcactttgacgacgcgaccctaaccaagcgacttgcccagggaacgggc
gaaatcctcaaaggggtaagaaacgtaggtcttttacgcgggcgtgaactaggcgacgcc
ggagatgatctggcacagaactggattgcacgtgtgctggaacaacaccgacccgatgat
ggattcctttctgaagaagccgcagataacccagaacgcctaggaaaagatcgtgtctgg
attattgatccgcttgacggcaccaaagagtttgccacagggcgccaagactgggctgta
cacatcgctttggtggaagacggaacgccgacccacgccgcagttaaccttcccgacttg
ggggttgtgttccatacctctgaagttcgtgcagtacgcggcccttatgccaagaagatc
gcggtctctcacaaccgtcctcccgctgtagccaaccacgtcgctgaaaaactaagtttt
actgctgagcctctcggttctgccggagcgaaagccatgcacgtgcttctcggcgactat
gatgcctacatccatgctggcggccaatatgagtgggactccgcagctcccgttggtgtc
agcctagcggctggactgcactgctcgcgtctcgatggctccccgctgacttataacaac
aaagacacctatcttccggatcttcttgtctgccgtcccgagcttgccgacgatatcctt
tccatggtggccgccttccgcgaggaaaacggctcgtactaa

DBGET integrated database retrieval system