KEGG   Corynebacterium pseudotuberculosis FRC41: cpfrc_00667Help
Entry
cpfrc_00667       CDS       T01277                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cpu  Corynebacterium pseudotuberculosis FRC41
Pathway
cpu00040  Pentose and glucuronate interconversions
cpu00052  Galactose metabolism
cpu00500  Starch and sucrose metabolism
cpu00520  Amino sugar and nucleotide sugar metabolism
cpu01100  Metabolic pathways
cpu01130  Biosynthesis of antibiotics
Module
cpu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    cpfrc_00667 (galU)
   00052 Galactose metabolism
    cpfrc_00667 (galU)
   00500 Starch and sucrose metabolism
    cpfrc_00667 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    cpfrc_00667 (galU)
Enzymes [BR:cpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     cpfrc_00667 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADK28461
Position
704345..705301
Genome map
AA seq 318 aa AA seqDB search
MDTGCTLICMKQPQEAQDSTRVAVKTVIVPAAGMGTRFLPATKTVPKELLPVVDTPGIEL
IAEEAAQLGATRLAVITAPNKQEVMEHFKRFPVLEETLQSRGKTEQYEKVVHASELIAPV
SVVQEKPLGLGHAVGMAESVLDPDEDAVAVMLPDDLVLPRGVVEKMVEVREQLGGSVLCA
FEVPEEEVYNYGVFEIDESAYDGPHHVKKVKGMVEKPSVEEAPSNFVATGRYLLDRAIFD
ALRRITPGAGGELQLTDAIDLLIDEGHPVHILVHDGKRHDLGNPGGYIPAVVDFGLRDPA
YGPHLKKVLRKILEEHGA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtggataccggatgtactcttatctgcatgaagcagcctcaagaagctcaagacagtacg
cgcgtcgcggtgaagactgtcatcgttcctgctgctggcatgggaacgagattccttcct
gccacaaaaacggttcctaaagaactgttaccagtggtagataccccaggcattgaactg
attgcagaagaagcagctcagttgggggcaactcgactcgcagtaattacggctcctaat
aagcaggaagtcatggagcactttaagcgattcccagtgttggaagagaccctacaaagc
cggggcaaaaccgaacaatatgaaaaagttgttcatgcctctgagcttattgcgccagtt
tccgtagtgcaggaaaagccgctcggccttgggcatgctgttggcatggcggaatcagtc
cttgatcctgatgaggatgccgtagcagtcatgcttcccgatgatctagtgcttccgcgg
ggcgttgtggagaagatggtcgaggtacgcgagcaactaggcggatccgtgttgtgcgcc
tttgaagtgccggaggaagaagtctataactacggtgtctttgagatcgatgagagtgca
tatgatggccctcatcacgtcaaaaaagtcaaaggaatggtagaaaaaccctctgtagaa
gaggctccttcaaattttgtggctaccggccgctatttgctcgatcgggctatttttgat
gcactccgtagaattaccccgggtgctggcggtgagctgcaactcacggatgccattgat
ttgcttatcgacgaaggccatcctgtgcatattcttgtgcatgacgggaagcgtcatgat
cttggcaaccccgggggatacataccggctgttgttgattttgggttgcgcgatccagcg
tatgggccgcacttaaagaaggtcctccgaaagattttggaagaacacggcgcataa

DBGET integrated database retrieval system