KEGG   Corynebacterium pseudotuberculosis FRC41: cpfrc_00879Help
Entry
cpfrc_00879       CDS       T01277                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cpu  Corynebacterium pseudotuberculosis FRC41
Pathway
cpu00010  Glycolysis / Gluconeogenesis
cpu00030  Pentose phosphate pathway
cpu00051  Fructose and mannose metabolism
cpu00052  Galactose metabolism
cpu00680  Methane metabolism
cpu01100  Metabolic pathways
cpu01110  Biosynthesis of secondary metabolites
cpu01120  Microbial metabolism in diverse environments
cpu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cpu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cpfrc_00879 (pfkA)
   00030 Pentose phosphate pathway
    cpfrc_00879 (pfkA)
   00051 Fructose and mannose metabolism
    cpfrc_00879 (pfkA)
   00052 Galactose metabolism
    cpfrc_00879 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    cpfrc_00879 (pfkA)
Enzymes [BR:cpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     cpfrc_00879 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     cpfrc_00879 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADK28673
Position
933653..934681
Genome map
AA seq 342 aa AA seqDB search
MRIATLTSGGDCPGLNAVIRGIVRTCSEYGSTVVGYEDGWVGLMEDKRIQLYDDENIDRI
LLRGGTILGTGRLHPDKFKAGLEQIKENLADAEIDALIPIGGEGTLKGAQWLSDNGIPVV
GVPKTIDNDVNGTDYTFGFDTAVSVATDAIDRLHTTAESHNRVMIVEVMGRHVGWIALHA
GMAGGAHYTVIPEHPFDLNEICKAMERRFQMGEKYGIIVVAEGALPKEGTMSFAQGCVDQ
FGHQTFNGIGQVIGEEIKRRLGHDVRTTVLGHIQRGGTPTAYDRVLATRYGVHAARACHT
QDFGKMVALHGEHIDLIPLEEAVGTLKVVPAARYRTARALFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgcgactttaacctctggcggcgattgccccggactcaacgctgtcatccgc
ggtatcgtccgcacctgttccgaatacggttctaccgttgtgggatatgaggacggttgg
gttggtcttatggaagacaagcgcattcaactttacgatgatgaaaatattgatcgtatt
cttttgcgcggcggaacgatcttgggaactggccgccttcaccccgataagttcaaggca
ggacttgagcaaatcaaagagaatttagcagacgccgaaattgatgctttgattccgatt
ggtggcgagggcacgctaaagggagcccaatggctttctgataatgggatccctgtggtg
ggcgtgcccaaaactatcgataatgatgtcaacggtaccgattacacctttggctttgac
accgcggtgtcggtagcaactgacgcaattgatcgtttacataccaccgcagaatcccac
aatcgcgtgatgatcgtggaagtgatggggcgtcatgtcgggtggatcgcattgcatgcg
gggatggcaggcggagcacactacactgtgattccagagcatccttttgatctcaatgag
atctgcaaagcgatggaacgccgtttccaaatgggggagaagtacggaattatcgtcgtt
gctgagggggctttgcctaaggaaggaacgatgagttttgcccaggggtgcgtagaccaa
tttgggcatcaaacctttaacggcatcggccaagtgatcggcgaagaaataaagaggcgc
ctaggtcacgacgtacgtactactgtgctcggacacatccaacgcggcggtactccgact
gcttatgatcgtgttttggcaacccggtatggtgttcacgctgcccgtgcttgccataca
caagactttggcaagatggtggcacttcatggtgagcatattgacctaattcctttggaa
gaagcagtaggaactttgaaggtagttcctgcggctagatatcggacagccagagctctc
tttggataa

DBGET integrated database retrieval system