KEGG   Corynebacterium pseudotuberculosis FRC41: cpfrc_01054Help
Entry
cpfrc_01054       CDS       T01277                                 

Gene name
mshC
Definition
mshC ligase
Orthology
K15526  
L-cysteine:1D-myo-inositol 2-amino-2-deoxy-alpha-D-glucopyranoside ligase [EC:6.3.1.13]
Organism
cpu  Corynebacterium pseudotuberculosis FRC41
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1145071..1146321)
Genome map
AA seq 416 aa AA seqDB search
MKSWPTPKIPAVPGEKVALSLYDTADRVIKPVNCSNGEVGVYVCGITPYDSTHLGHAATY
LAFDLINRQLIDAGHTVHFVQNITDVDDPLFERAERDGVSWRELGTDQINLFRSDMEALS
VIPPRDYVGAMEAIDEVIEMVQALLDNGSAYIVDVDQYRDIYASTSATSHFGYESNYSRD
LMEEFFAERGGDPERPGKKDPLDALIWRSARKGEPSWDAPFGAGRPGWHIECSAIATNRL
GNNFAIQGGGSDLIFPHHEFSAAHAEAAHHVHRMANHYVHAGMIALDGVKMSKSLGNLVF
VSQLTADGHHPSAIRLGLYSGHYRSPREWSEKILSDAEKRRELWINAADTATDLQAAQNL
VASIRFYLSQDLDTPKALAAVDAWAKAIEKNESSRERAAAGDLVACALDALLGVKI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcatggcccacaccaaaaatcccagctgtgccgggagaaaaagtagcgctttct
ctgtacgacacagcggaccgagtgattaagccggtgaactgcagtaatggggaagttggt
gtgtatgtatgcgggattaccccttatgattccacgcacctagggcatgcagctacatac
ctcgcgtttgatttaattaaccgacagcttatcgacgccggccataccgtccattttgta
caaaatattacggatgtagacgatccccttttcgagcgcgcagaacgtgacggtgtgagt
tggcgagagctcggaactgatcagataaacctttttcgttcagacatggaagcattgtcc
gtaatccctcctcgcgactacgtaggggcaatggaagccatcgatgaagtcatcgagatg
gtccaggctctgctggataacggttccgcctacatcgtcgatgttgatcaatatcgcgat
atctacgcttcgacctccgcaacgagtcactttggttatgagtctaattattcacgcgac
cttatggaggaattctttgcagaaagaggcggcgatcctgagcgccccgggaaaaaagat
ccccttgatgccttaatctggcgatctgcacgtaaaggtgaaccttcatgggacgcacct
tttggagcagggcgccctggatggcatatagaatgctcagcgattgctacgaacagactc
ggaaacaattttgcaatacaaggcgggggttccgatctaatttttccgcaccatgaattt
tctgctgcgcatgcggaagcagcacaccacgtgcataggatggccaaccattacgtgcat
gctggaatgatcgccttagacggcgtcaagatgagcaagtctttaggaaatctcgtcttt
gtatctcagctcacagctgacggacaccatccttccgctatccgtcttggcctctattca
ggccactatcggtctccacgcgaatggtcagaaaaaattctttctgatgcagaaaagcgc
cgagagctatggattaatgctgctgacacagcaacagatttacaagcagctcaaaatcta
gtggctagcatcagattctatctatctcaagatcttgatacccctaaagcgcttgcggct
gtggatgcatgggcaaaagcaatagaaaaaaatgaatcttcacgcgaacgagcagcagcc
ggggatctggtggcctgcgccttagacgctcttttaggcgtaaaaatttaa

DBGET integrated database retrieval system