KEGG   Corynebacterium pseudotuberculosis FRC41: cpfrc_01177Help
Entry
cpfrc_01177       CDS       T01277                                 

Gene name
ruvA
Definition
holliday junction resolvasome helicase subunit A (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cpu  Corynebacterium pseudotuberculosis FRC41
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cpu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1288113..1288724)
Genome map
AA seq 203 aa AA seqDB search
MIVSLRGTVASIGLGSAVIECNGVGYEVLASPSTLSQMRRGEEFFVLTTMVVREDSQTLY
GFASDEARQMFTLLQTVSGLGPKLALAAQSVLSAVDLAQAIANQDAKTLQRIPGVGKRVA
ERIIVDLKDKVSAFITDGGATPASGGSSSATSDVSAQVLEALLGLGFTEKVAEPALNSVL
SESPNATTSQALRLALSTLGKKK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtttcccttcgcgggactgtagcctccatcggtcttggtagcgcagttattgaa
tgtaacggggttgggtatgaggtgctcgctagtcccagcactttgtctcaaatgcgcaga
ggcgaagaattctttgtcctgactacgatggtggtcagagaagactcccaaactctttat
gggtttgctagtgatgaagctcggcagatgtttacgctgctgcagactgtctctggacta
gggccaaagctggcgttggcggcacaatcagtgttgtcagcagtggatttagctcaggcg
attgctaatcaggatgcaaaaactctacaacgtatccccggggtgggaaagcgagtcgca
gagcggattattgtcgacctcaaagacaaggtttcagcttttattaccgatgggggtgct
acccctgcgtcgggaggctcatcttctgcaacgagtgatgtttccgcacaggtgttggag
gctcttctcggacttggttttacagagaaagttgcagaacctgcgttgaattccgtgttg
agcgaatctccgaacgctactacatcccaggcgctgcggttagccctgagcacgctgggg
aaaaagaaatag

DBGET integrated database retrieval system