KEGG   Corynebacterium pseudotuberculosis FRC41: cpfrc_01210Help
Entry
cpfrc_01210       CDS       T01277                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cpu  Corynebacterium pseudotuberculosis FRC41
Pathway
cpu00010  Glycolysis / Gluconeogenesis
cpu00520  Amino sugar and nucleotide sugar metabolism
cpu01100  Metabolic pathways
cpu01110  Biosynthesis of secondary metabolites
cpu01120  Microbial metabolism in diverse environments
cpu01130  Biosynthesis of antibiotics
cpu01200  Carbon metabolism
Module
cpu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cpfrc_01210 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    cpfrc_01210 (ppgK)
Enzymes [BR:cpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     cpfrc_01210 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ADK29003
Position
1319477..1320280
Genome map
AA seq 267 aa AA seqDB search
MSCNCARSRVPFSKLKFMTRIGFGIDVGGSGIKGARVDLDTGDFVGDRIKILTPKPATPE
AVAQTISRIVAEAEWEGPVGITLPSVIRNQVALSAANIDQSWINVDVQKLFTKTLGGRNI
AVLNDADAAGIAEVAFGEDQARRGSAILLTLGTGIGSAFFINGVLFPNTELGHMIVEGKE
AEHLASSAAKDRDELSYSKWAKRVSKVLSEYERLFWPDVFIVGGGISRKADKWVPKLTID
TPVIPAKLRNTAGIVGAAMAADQNIRP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcaattgtgctcgtagccgcgtgccattcagtaagctcaagttcatgacacga
attggctttggcattgatgttggcggatctgggattaaaggtgcccgcgttgatctggat
accggtgattttgtcggagatcggatcaaaattttaacccccaagcctgccacccccgaa
gcggtcgcccaaacgatttctcgcattgttgcagaggccgaatgggaaggacccgtcgga
ataacgctgccttccgtaatccggaatcaagtagcactttctgccgccaacattgaccaa
tcatggatcaatgttgatgttcaaaaattatttaccaagaccctgggcgggcgtaacatc
gcagtgcttaacgacgccgatgcggcgggcatcgccgaggtagccttcggagaagatcaa
gctcgacgtggttccgccattttgctcactctaggcactgggatcggttccgctttcttt
atcaacggggtcttattccccaacaccgagttagggcacatgatcgtagagggaaaggaa
gccgagcatctagcttcatctgcagcaaaagatcgcgatgagttgagctattccaaatgg
gccaagcgcgtttctaaagtcctcagcgaatacgaacgacttttttggccagacgttttt
atcgtaggcggtggtatctcacgcaaagctgataaatgggtacccaaactcactatcgat
acgcccgtcatacctgcaaaactacgtaataccgcaggtatcgtaggagcagcaatggcg
gcagaccaaaatatcaggccttag

DBGET integrated database retrieval system