KEGG   Corynebacterium pseudotuberculosis FRC41: cpfrc_01288Help
Entry
cpfrc_01288       CDS       T01277                                 

Gene name
cysG
Definition
multifunctional uroporphyrin-III C-methyltransferase/precorrin-2 oxidase/ferrochelatase (EC:4.99.1.4)
Orthology
K02303  
uroporphyrin-III C-methyltransferase [EC:2.1.1.107]
Organism
cpu  Corynebacterium pseudotuberculosis FRC41
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    cpfrc_01288 (cysG)
Enzymes [BR:cpu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     cpfrc_01288 (cysG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1404457..1405209)
Genome map
AA seq 250 aa AA seqDB search
MTSQQNQWQAPVSLIGGGPGAWDLITVRGMRRLQTADVILADHLGPASELDKLCDVTAKE
IIDVSKLPYGRQVAQSKINELLVHHAQLGKRVARLKGGDPYIFGRGFEELQACAAQGIAC
EVIPGVTSAVSVPALAGVPITQRGLVHSFTVVSGHVPPQHPESLNNWSALAQTQGTLSVI
MGVKNAPAIADALIDGGRPASTPVVIIQEGATEQQRSYKCTLGTLASTMRTQEIKPPAVY
VIGEVAGLDA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacttcccagcagaatcaatggcaggccccagtctcacttatcggcggagggccagga
gcatgggacctgattactgtcagagggatgcgtcggctgcaaacagcggacgtaattttg
gcggatcatttaggcccggcgtcggagctggacaagctttgcgacgtcaccgcgaaagag
atcatcgacgtatccaagcttccatacggccggcaagtagcccaatcgaaaatcaacgag
ctgctcgtacaccatgcacaattagggaaaagagtcgctcggcttaaaggcggcgacccg
tacatctttggtcgaggctttgaagaactacaggcttgcgcagcgcaaggaattgcttgt
gaagtgatccctggagtaacaagcgctgtttctgtaccagcacttgccggtgtccctatt
actcagcgaggactcgttcacagctttaccgtggtatccggacacgtaccaccccagcat
ccggaatccctcaacaactggagtgcactggcacaaacacaaggaacattgagcgttatt
atgggcgtgaaaaacgcgccagctattgccgatgctcttatcgacggtggccgaccggct
tccactcccgtggtgataattcaagaaggtgccacagaacaacaacgctcctataaatgc
acactcgggaccctcgccagcaccatgcgcacacaggagattaaaccgcccgctgtctat
gttattggagaagtcgccggactagatgcataa

DBGET integrated database retrieval system