KEGG   Corynebacterium pseudotuberculosis FRC41: cpfrc_01295Help
Entry
cpfrc_01295       CDS       T01277                                 

Definition
hypothetical protein
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cpu  Corynebacterium pseudotuberculosis FRC41
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    cpfrc_01295
Enzymes [BR:cpu01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     cpfrc_01295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1411267..1412349)
Genome map
AA seq 360 aa AA seqDB search
MGTCGRTLYPFSAVVGQERLRLALLLCAISPRIGGVVIRGEKGTAKTTTVRAFARLLGEA
PLVDLPIGATEDRVVGSLDMETVLTTGKARYNPGLLSQADGGVLYVDEVNLLADHLVDSL
LDAAATGQVTVERDGISYSSPANFVLVGTMNPEEGELRPQLLDRFGLAVDVMASKDTDVR
AEIMRRRLAFESAPQSFAQAWSHEDASTALQIQKAKQRVQQLQLSNVNLNRIAHLCAAFD
VDGMRADLVIARTALAHAAWRGASMVEDEDIRIAAELALPHRRRRDPFDEPGLDQEQLDQ
EMEKARDQHPDASDKAEEPQEEKEQHTLENKSSETQSEQPTSDGQEECATTGAPFRSTGA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggcacctgtggacgcacactatatcctttctctgcagtagtagggcaggagcgatta
agactggcattactcttatgcgcaatttctccgcgtattggtggtgtagttatccgcggg
gaaaagggaacagcgaagaccactacggtgcgagcttttgcgcgtttgctaggagaagcc
cctttagttgatctccctatcggtgccacagaggatcgagtcgtggggtccctggatatg
gagacagtcttgaccaccggaaaagctcgctataacccgggcttgcttagtcaagcagac
ggtggggtgttgtacgtcgatgaggtaaatctcctcgcagatcacctcgtcgattcgctc
ttagacgcggcggcaacggggcaagtaacagttgaacgggatggcatttcttattcttct
cctgccaactttgtgctcgtggggacaatgaacccagaagaaggcgagttgcggccgcaa
ttgcttgatcgtttcggattggctgttgacgttatggcgtccaaagacactgatgtacga
gcagaaataatgcggcgtcggcttgctttcgaatcagccccgcaatcttttgcacaagcg
tggtcccatgaggatgcatcgacggcgctgcaaatacagaaggcgaaacaacgagtgcag
cagttacaactttctaacgttaatctgaaccggatcgcacatttgtgtgcagcatttgac
gtggacggtatgagagctgatttggttatcgctcgaactgcgctagcacatgctgcctgg
cgcggagcttcaatggttgaagatgaggatatccggatagccgcagagttggccttgccg
catcgccgtcgcagagacccattcgatgagcctggcctagaccaggaacagctggatcaa
gaaatggaaaaagcccgggatcagcaccctgacgccagtgataaagcggaagagcctcaa
gaggaaaaagagcagcatacactagagaacaagtcttcggagactcaatctgagcagccc
accagtgacggtcaggaggaatgcgctactactggcgctccctttcgctccacgggtgct
taa

DBGET integrated database retrieval system