KEGG   Corynebacterium pseudotuberculosis FRC41: cpfrc_01354Help
Entry
cpfrc_01354       CDS       T01277                                 

Gene name
trpC2
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cpu  Corynebacterium pseudotuberculosis FRC41
Pathway
cpu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpu01100  Metabolic pathways
cpu01110  Biosynthesis of secondary metabolites
cpu01130  Biosynthesis of antibiotics
cpu01230  Biosynthesis of amino acids
Module
cpu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    cpfrc_01354 (trpC2)
Enzymes [BR:cpu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     cpfrc_01354 (trpC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh OMPdecase QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADK29147
Position
complement(1484671..1485480)
Genome map
AA seq 269 aa AA seqDB search
MPSVFEEIIAGVIEDVAARESVVSFKEIKARSRACEPPRDAIAALLNSGCGVIAEIKRAA
PDKGVLAEINSPVGLAKELVAGGASLIACQTERRRFHGSLSEMAEIRNVISVPIMCRDFI
VDPYQIHEARCYGADMVPLRVAALDQARMIALIDRIESLGMAALVEVRDTEEASRAVAAG
AKIIGVNARDFSTMTLNRLAFAEIAPGLPTDVIRVALSGVRNARELLDYAASGADAVVVG
EKIVTAADPCEATRSLVAAGQHPSCPSRG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgccatcagtcttcgaagagattattgcgggcgtcattgaagatgtagctgcgcgagaa
tcagtggtgtcgtttaaagagatcaaagcccgttcgcgtgcttgcgagccgcctcgggat
gcaatagcggcgcttcttaatagtggttgtggcgtgatcgctgagattaaacgtgctgcc
ccagataaaggcgttttagcagagatcaattctcctgttggcttagcaaaagaacttgtc
gccgggggcgctagtttgattgcgtgtcagacggaacggcgaaggttccacggttcatta
tctgagatggctgagattcgtaatgtgatatcggtgccaataatgtgccgagacttcatc
gtggatccctatcaaattcatgaggcgcgctgttatggagcggacatggtgcccttgcgc
gtagctgctttagaccaagccaggatgattgcgcttatagatagaatcgagtccctggga
atggcagcgctggtagaagtccgggatactgaggaagcatcgcgtgcggtggcagcgggt
gcgaagatcataggggtaaacgcccgggatttctcaacgatgacgctcaaccgcctggcc
ttcgcagaaattgctcctggacttcccacagatgttattagagttgcattgtccggtgtg
cgcaatgctcgtgaactcctggattacgctgcctctggtgcggacgcggtggttgtggga
gaaaaaattgttactgctgcggatccgtgcgaagcgacgcgttcgttggtggcagcaggc
caacatccatcgtgtccatcgcgaggataa

DBGET integrated database retrieval system