KEGG   Corynebacterium pseudotuberculosis FRC41: cpfrc_01438Help
Entry
cpfrc_01438       CDS       T01277                                 

Gene name
sucB
Definition
dihydrolipoamide acyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cpu  Corynebacterium pseudotuberculosis FRC41
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cpfrc_01438 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    cpfrc_01438 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    cpfrc_01438 (sucB)
Enzymes [BR:cpu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     cpfrc_01438 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1577854..1579845
Genome map
AA seq 663 aa AA seqDB search
MAHSVEMPELGESVTEGTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGVLLEVR
FNEDDTVDVGDVIAIIGEEGEAPAASDSDEKKEEPKQEAPKAEPTKEAPKGSGSSTDVVM
PELGESVTEGTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGVLLEVRFNEDDTV
DVGDVIAIIGEEGEAPAASDSDEKKEEPKQEAPKAEPTKEAPKGSGSSTDVVMPELGESV
TEGTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGVLLEVRFNEDDTVDVGDVIA
IIGEEGEAPAASDSDEKKEEPKQEAPKAEPTKEAPKEEPAKEAAKPVDNQNVPYVTPLVR
KLANKYGVDLNKVEGTGVGGRIRKQDVLAAAGQGSEPAQKEAPAAVKDPRANWSTKSVDP
AKAELIGTTQKVNRIREITAKKMVEALQISAQLTHLQEVDMTNVATLRKDNKPAFIEKYG
VNLTYLPFFVKAVVEALVLHPNVNASYNAATKEITYHSDVNIAIAVDTERGLLTPVIHKA
QELTLPEIAQAIVDLADRARNNKLKPNDLSGATFTVTNIGSEGALADTPILVPPQVGILG
TAAIQKRPVVITENGSDAIAIRQMCYIPFSYDHQIVDGADAGRFTATIKDRLEKAKFQDD
LNL
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgaaatgcctgagctgggcgaatccgtcaccgagggaacaattacc
cagtggctcaagtctgtcggcgacaccgtcgacgtcgacgagccgttgctcgaggtttcc
actgacaaggttgacaccgaggttccttcccccgttgcgggcgttctgttggaggttcgc
ttcaacgaagacgacaccgttgatgtcggcgatgttatcgccatcatcggtgaggaaggt
gaggctcctgccgcaagcgattctgatgagaagaaggaagagccgaagcaggaagcaccc
aaggcagaacccaccaaggaagcacctaagggctccgggtcctccaccgacgtggtcatg
cctgagctgggcgaatccgtcaccgagggaacaattacccagtggctcaagtctgtcggc
gacaccgtcgacgtcgacgagccgttgctcgaggtttccactgacaaggttgacaccgag
gttccttcccccgttgcgggcgttctgttggaggttcgcttcaacgaagacgacaccgtt
gatgtcggcgatgttatcgccatcatcggtgaggaaggtgaggctcctgccgcaagcgat
tctgatgagaagaaggaagagccgaagcaggaagcacccaaggcagaacccaccaaggaa
gcacctaagggctccgggtcctccaccgacgtggtcatgcctgagctgggcgaatccgtc
accgagggaacaattacccagtggctcaagtctgtcggcgacaccgtcgacgtcgacgag
ccgttgctcgaggtttccactgacaaggttgacaccgaggttccttcccccgttgcgggc
gttctgttggaggttcgcttcaacgaagacgacaccgttgatgtcggcgatgttatcgcc
atcatcggtgaggaaggtgaggctcctgccgcaagcgattctgatgagaagaaggaagag
ccgaagcaggaagcacccaaggcagaacccaccaaggaagcacctaaggaagaaccggct
aaagaggctgcaaagccagtcgataaccaaaacgttccttatgtgaccccattggtacgc
aagcttgctaataagtacggcgttgacctcaataaggtcgaaggtaccggcgttggcggc
cgtatccgtaagcaagacgttctcgccgcagccgggcaaggatctgagccggctcaaaaa
gaagcccctgctgctgttaaggatcctcgcgctaactggtccaccaagagcgttgatcct
gcaaaggcagagcttattggtaccacccagaaggtcaaccgcatccgcgagatcacggct
aagaagatggtcgaggcattgcagatttctgcacagctcacgcatcttcaagaggtggat
atgaccaacgttgccacgctgcgcaaggacaacaagccggcattcatcgaaaagtatggc
gttaacctgacctacctgccgttctttgttaaggccgtggttgaggctctagtcctgcac
ccgaacgtgaatgcgtcttacaacgctgccaccaaggagatcacttaccactccgacgtc
aatattgcgattgcagtggataccgagcgcggtctgctcacccctgtgatccacaaggcc
caggagcttacgttgccggagatcgctcaggctattgttgatctggccgatcgcgcccgt
aacaataagctgaagccaaacgacctatccggcgcaaccttcactgtgaccaatatcggt
tccgagggtgccttggcagataccccaatcttggttccaccgcaggttggtatcttgggc
accgctgcgatccagaagcgcccagtggtaatcactgagaatggctcggacgccatcgca
atccgtcaaatgtgctacatcccgttctcttatgatcaccagatcgtagacggcgctgat
gccggtcgcttcaccgcgacgatcaaggatcgcctggaaaaggctaagttccaggacgac
ctcaacctctaa

DBGET integrated database retrieval system