KEGG   Corynebacterium pseudotuberculosis FRC41: cpfrc_01438Help
Entry
cpfrc_01438       CDS       T01277                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide acyltransferase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cpu  Corynebacterium pseudotuberculosis FRC41
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cpfrc_01438 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    cpfrc_01438 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    cpfrc_01438 (sucB)
Enzymes [BR:cpu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     cpfrc_01438 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1577854..1579845
Genome map
AA seq 663 aa AA seqDB search
MAHSVEMPELGESVTEGTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGVLLEVR
FNEDDTVDVGDVIAIIGEEGEAPAASDSDEKKEEPKQEAPKAEPTKEAPKGSGSSTDVVM
PELGESVTEGTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGVLLEVRFNEDDTV
DVGDVIAIIGEEGEAPAASDSDEKKEEPKQEAPKAEPTKEAPKGSGSSTDVVMPELGESV
TEGTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGVLLEVRFNEDDTVDVGDVIA
IIGEEGEAPAASDSDEKKEEPKQEAPKAEPTKEAPKEEPAKEAAKPVDNQNVPYVTPLVR
KLANKYGVDLNKVEGTGVGGRIRKQDVLAAAGQGSEPAQKEAPAAVKDPRANWSTKSVDP
AKAELIGTTQKVNRIREITAKKMVEALQISAQLTHLQEVDMTNVATLRKDNKPAFIEKYG
VNLTYLPFFVKAVVEALVLHPNVNASYNAATKEITYHSDVNIAIAVDTERGLLTPVIHKA
QELTLPEIAQAIVDLADRARNNKLKPNDLSGATFTVTNIGSEGALADTPILVPPQVGILG
TAAIQKRPVVITENGSDAIAIRQMCYIPFSYDHQIVDGADAGRFTATIKDRLEKAKFQDD
LNL
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgaaatgcctgagctgggcgaatccgtcaccgagggaacaattacc
cagtggctcaagtctgtcggcgacaccgtcgacgtcgacgagccgttgctcgaggtttcc
actgacaaggttgacaccgaggttccttcccccgttgcgggcgttctgttggaggttcgc
ttcaacgaagacgacaccgttgatgtcggcgatgttatcgccatcatcggtgaggaaggt
gaggctcctgccgcaagcgattctgatgagaagaaggaagagccgaagcaggaagcaccc
aaggcagaacccaccaaggaagcacctaagggctccgggtcctccaccgacgtggtcatg
cctgagctgggcgaatccgtcaccgagggaacaattacccagtggctcaagtctgtcggc
gacaccgtcgacgtcgacgagccgttgctcgaggtttccactgacaaggttgacaccgag
gttccttcccccgttgcgggcgttctgttggaggttcgcttcaacgaagacgacaccgtt
gatgtcggcgatgttatcgccatcatcggtgaggaaggtgaggctcctgccgcaagcgat
tctgatgagaagaaggaagagccgaagcaggaagcacccaaggcagaacccaccaaggaa
gcacctaagggctccgggtcctccaccgacgtggtcatgcctgagctgggcgaatccgtc
accgagggaacaattacccagtggctcaagtctgtcggcgacaccgtcgacgtcgacgag
ccgttgctcgaggtttccactgacaaggttgacaccgaggttccttcccccgttgcgggc
gttctgttggaggttcgcttcaacgaagacgacaccgttgatgtcggcgatgttatcgcc
atcatcggtgaggaaggtgaggctcctgccgcaagcgattctgatgagaagaaggaagag
ccgaagcaggaagcacccaaggcagaacccaccaaggaagcacctaaggaagaaccggct
aaagaggctgcaaagccagtcgataaccaaaacgttccttatgtgaccccattggtacgc
aagcttgctaataagtacggcgttgacctcaataaggtcgaaggtaccggcgttggcggc
cgtatccgtaagcaagacgttctcgccgcagccgggcaaggatctgagccggctcaaaaa
gaagcccctgctgctgttaaggatcctcgcgctaactggtccaccaagagcgttgatcct
gcaaaggcagagcttattggtaccacccagaaggtcaaccgcatccgcgagatcacggct
aagaagatggtcgaggcattgcagatttctgcacagctcacgcatcttcaagaggtggat
atgaccaacgttgccacgctgcgcaaggacaacaagccggcattcatcgaaaagtatggc
gttaacctgacctacctgccgttctttgttaaggccgtggttgaggctctagtcctgcac
ccgaacgtgaatgcgtcttacaacgctgccaccaaggagatcacttaccactccgacgtc
aatattgcgattgcagtggataccgagcgcggtctgctcacccctgtgatccacaaggcc
caggagcttacgttgccggagatcgctcaggctattgttgatctggccgatcgcgcccgt
aacaataagctgaagccaaacgacctatccggcgcaaccttcactgtgaccaatatcggt
tccgagggtgccttggcagataccccaatcttggttccaccgcaggttggtatcttgggc
accgctgcgatccagaagcgcccagtggtaatcactgagaatggctcggacgccatcgca
atccgtcaaatgtgctacatcccgttctcttatgatcaccagatcgtagacggcgctgat
gccggtcgcttcaccgcgacgatcaaggatcgcctggaaaaggctaagttccaggacgac
ctcaacctctaa

DBGET integrated database retrieval system