KEGG   Corynebacterium pseudotuberculosis FRC41: cpfrc_01790Help
Entry
cpfrc_01790       CDS       T01277                                 

Gene name
folP2
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cpu  Corynebacterium pseudotuberculosis FRC41
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    cpfrc_01790 (folP2)
Enzymes [BR:cpu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     cpfrc_01790 (folP2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1962076..1962858)
Genome map
AA seq 260 aa AA seqDB search
MTEVMGIVNVTTDSFSDGGKYLDVDSAVAHAKKLVAEGADIIDVGGESTRPGATRVSEEV
ELARVIPVITALHAEGIKTSVDTMRASVAAAAAEAGAGLLNDVSGGLADKNMYSVMADTE
LPVCLMHWKTTTFGDASGAHHTDVVRDVREGLNVLVDNALAAGVDAQAIAIDPGLGFAKT
AEDNWALLNALPEFMSNYPVLLGASRKRFLASLGVDTDAATAAVTAIAAHHGVWCVRVHN
VALSRAAVDVAAKWRNHGSH
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacggaagtaatgggaatcgtcaacgtaaccaccgattccttttctgatggtgggaaa
taccttgacgtagattccgccgtggcccatgccaaaaaacttgtggcagagggcgcagat
atcatcgacgtgggtggggaatccacccgaccaggtgctactcgagtgagcgaagaagta
gagctcgctcgagttattcctgtcattacagctctgcacgctgaaggaattaaaacatcg
gtggacaccatgcgagcctcagttgcggctgccgccgctgaggccggggcgggcttgctt
aatgacgtctccggtggccttgcagacaaaaatatgtattcagttatggctgataccgag
cttccggtgtgcctgatgcattggaagacaacaacctttggagatgcctcaggagcgcac
cataccgatgtggtgcgcgatgtccgtgaaggcttgaacgtgctcgttgacaatgccctt
gccgctggtgttgacgcgcaagctattgctattgacccaggtctcggttttgctaaaact
gcagaggacaattgggccttgctcaatgcccttccagaatttatgagcaactatccggtg
ttgctgggggcgtcgagaaagcgctttttagctagcctaggcgtagacacagacgctgct
actgccgcagtcaccgcaatcgctgctcatcatggagtgtggtgcgtccgggtgcacaat
gtggcgctatcccgtgctgccgtagatgttgcggcgaaatggaggaatcatggatcgcat
tga

DBGET integrated database retrieval system