KEGG   Corynebacterium pseudotuberculosis FRC41: cpfrc_01938Help
Entry
cpfrc_01938       CDS       T01277                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cpu  Corynebacterium pseudotuberculosis FRC41
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cpu00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:cpu00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2128177..2129361)
Genome map
AA seq 394 aa AA seqDB search
MRRLRESDSKAIHVTIPWFTGWAMHMKRLLAAALLGVLAACSDAGTNTDPTSTEATTALT
TQETSAPASAKPQPEDVRAKAASLMMVGVSNYDDALAALNQGAGGIFIGSGTDPNLLTAP
DRNIQALRKAVGRDFSVSIDFEGGRVLRHQGILGTFPSPQVMAQTMNPEQVRGMAKAMGD
SLLAHGVTVNFAPVADIDAGLDVVGDRAFSADPNIDAEYATAFAQGMLDAGVRPVFKHFP
GHGRASGDSHTGQVFTPPLGDLENIDLVPYGRINVPGAGVMLGHMVVPDLGAPQNGLPST
LNPAAYQLLRTGAYRDGRPFAGVVYTDDLAMGAITGVMPIPQAVVASLQAGADQALWVTT
AGLKEAIDATVAAVETGTYPRAQFEESVRRVGVV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcggttaagagaatcggattcaaaagccatacatgtaacaataccgtggtttact
ggatgggcaatgcacatgaaacgacttctcgccgccgccctcctcggtgtgctcgctgca
tgtagcgacgccggaaccaatacggatcccaccagcactgaggccaccactgcgttaaca
acgcaggaaaccagcgcgcctgcaagcgcaaaaccacagcctgaggacgtccgcgctaaa
gccgcgagcctgatgatggtgggcgtaagcaattacgacgacgcccttgctgccctaaac
caaggcgctgggggcatcttcatagggtccggcaccgatcccaatcttctcaccgctccg
gatagaaacattcaggcgctgcgtaaggccgtggggcgagacttttctgtctcgatcgat
tttgagggagggcgtgttctccggcatcagggaattctgggaaccttcccctcgccccaa
gtgatggcacaaaccatgaaccccgagcaggttcgagggatggccaaagcgatgggcgac
tcattgctggctcacggagtgaccgtgaattttgctccggtcgcggatatagacgctgga
ttagacgttgtgggcgatcgtgcctttagcgcagacccaaatattgatgcggaatacgcc
acagcttttgcccaaggaatgcttgatgctggggtccggccagtgtttaagcacttcccg
gggcatggccgcgccagtggcgattcacacacaggacaggtattcacgccccctctaggt
gacctggaaaacattgacctagttccttatggccggattaatgtccccggtgccggcgtg
atgctcgggcatatggtggttcctgatctaggcgctccccagaacggacttccgtccacc
ctcaatccggccgcataccagttactacgcactggggcttatcgtgatgggcgtcctttc
gccggcgtggtctacacggatgatcttgctatgggagcaatcaccggggttatgcctatc
cctcaagccgtagtggcctcgctgcaagctggcgcagatcaggctttgtgggtgaccact
gcggggcttaaagaagctatcgacgctaccgtggctgccgtggaaaccggcacgtatccc
agggctcaatttgaagagtcggtacgccgggttggtgttgtttaa

DBGET integrated database retrieval system