KEGG   Corynebacterium pseudotuberculosis FRC41: cpfrc_02073Help
Entry
cpfrc_02073       CDS       T01277                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cpu  Corynebacterium pseudotuberculosis FRC41
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cpfrc_02073
Enzymes [BR:cpu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     cpfrc_02073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2295529..2296047)
Genome map
AA seq 172 aa AA seqDB search
MPIIAPWFGKLMGHKELQHGWARRQKWEVLETSGGLDARMSHDDWDLRLAVQSTPRGFAM
MLKCRNASSVCRKLQLAFHPYFYVSDVLDTIVTAPGETFTTDGGLLEEFRLSAPTPLLID
DGQRLITVKGQGTDHFIVWNPGEKLASEMSDMGTGEWRNFVCVEPALLGEDS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
gtgcccattattgctccgtggtttggcaaacttatgggacacaaggagctgcaacatgga
tgggcgcgccggcagaaatgggaggtgctagagacctcgggtgggctcgacgctcgaatg
agtcatgatgattgggacttgcgtttggcagtccagtcgacgccgcgaggttttgccatg
atgctgaaatgtagaaacgcctcaagcgtttgccggaagcttcagttggcgttccatcca
tatttttatgtctctgacgttcttgataccatcgtgaccgcccccggtgagacctttact
acggacggtggtttgttggaggaatttcgcctctccgctcccacgcctctgcttatcgat
gacggccagcgtctcatcaccgttaaagggcaagggactgatcactttattgtgtggaac
cctggcgagaaactggcgagtgagatgtccgatatgggcactggggaatggcgaaacttt
gtctgtgtagagcccgctctcctaggggaagactcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system