KEGG   Corynebacterium pseudotuberculosis FRC41: cpfrc_02086Help
Entry
cpfrc_02086       CDS       T01277                                 

Gene name
trpC1
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
cpu  Corynebacterium pseudotuberculosis FRC41
Pathway
cpu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpu01100  Metabolic pathways
cpu01110  Biosynthesis of secondary metabolites
cpu01130  Biosynthesis of antibiotics
cpu01230  Biosynthesis of amino acids
Module
cpu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    cpfrc_02086 (trpC1)
Enzymes [BR:cpu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     cpfrc_02086 (trpC1)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     cpfrc_02086 (trpC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: ADK29879
Position
2310164..2311651
Genome map
AA seq 495 aa AA seqDB search
MQNNVPMPTVLEEIVNTRRSHIQEISARISHINPLRLPRSTKSLFQALGGSINGGAASRR
QAYSNASTRAPHFIMECKSASPSLGTIRTDYSPGDIARIYSRYASAISVLCEPDKFNGDY
DHLATVAASTHLPVLCKDFIVDPVQVQAARYFGADAVLLMLSVLDDATYLSLSSEAERLG
LDVLTEVINEEEVKRGIRLGAKIFGVNHRNLHDLSIDLSRSSQLEPLIPENAVLVSESGI
KTNETVRQLAGHSDAFLVGSQLTSHSNIDSASRSLVYGTNKVCGLTTASAAQNARAVGAT
HGGLIFEDSSPRNVSRETAEKIIAAEPNLNYVAVSRRDHGWEEILLPEITSLQIHAPYQG
SIAGERALIDNARRELQKAGREDVSIWRAVSMTLPEGAATATALTDDVDMLLLDAGIGGT
GTSFNWEKITPDIAPKAILAGGLNLDNLPEALKAGCAGLDLNSGFEYPSTAGSWSGMKDS
GLLRQAFSKIRNFHY
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaataatgtgcccatgcccacggttctagaagaaatcgttaatacgcgaagatca
cacatccaagagatcagcgcgcgcatttcacatataaacccgctccggctaccgaggtcc
acaaagtccctttttcaggcgcttggaggttctatcaacgggggagcagcctcgcgtcgt
caagcttattccaacgcatccaccagagcaccgcactttattatggaatgcaaatctgca
tcaccatcattaggcacaatccgtaccgactattccccgggagatattgcacgcatttat
tctcgatatgcttctgcaatttccgttctttgtgaacccgacaagttcaacggcgactac
gaccacttggccactgtcgcggcttccacgcatttgccggtcttatgcaaggactttatc
gtcgaccctgtgcaggttcaggctgctcgttactttggcgcggacgcggtcttgctcatg
cttagcgtgcttgacgacgccacctacctctcactttctagcgaagccgaacgtctcgga
ctcgatgtgctcaccgaagtaataaacgaagaagaagtaaaaaggggtattcgtctcggg
gctaagatatttggcgttaatcaccgcaacctacacgatctcagcatcgacctttcccgc
tcctcacagctagagcctctcattccagaaaacgccgtattagtatcagaatctggcatc
aaaacaaatgagaccgttagacaactagctggacattccgacgctttccttgtgggctcc
cagctcaccagccacagcaacattgactccgcctcccgttcactcgtttacggaaccaat
aaggtatgcggtctcaccacggcttccgcagcgcagaatgctcgcgcagttggcgcaaca
cacggggggctaatttttgaagactctagcccccgcaatgtttcacgtgaaaccgccgaa
aaaatcattgcagcggagcccaacctgaactacgttgcagtgagcagacgcgaccatgga
tgggaggaaatacttcttccagaaattacgagtctccaaatccatgccccataccaggga
tccatagcaggggagagggcgctcatcgataatgcccgtcgggagcttcaaaaagcggga
agggaagatgtctccatctggagagctgtgtccatgacacttccagagggagccgccacc
gctaccgcactgacggatgacgtagatatgttgcttctcgacgccggcattggaggcacc
ggaacatcgtttaattgggaaaaaatcacgccagatatagcccctaaagcgatcctggca
ggaggtcttaacctcgacaatcttcctgaagctttaaaggcaggatgtgccggcctggat
ctcaattctggtttcgagtacccatccaccgctgggtcatggtctgggatgaaagattcc
ggattgctacggcaagcgttctccaagatccggaattttcattattag

DBGET integrated database retrieval system