KEGG   Coniophora puteana: CONPUDRAFT_114990Help
Entry
CONPUDRAFT_114990 CDS       T03134                                 

Definition
NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cput  Coniophora puteana
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cput00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CONPUDRAFT_114990
Enzymes [BR:cput01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CONPUDRAFT_114990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
Unknown
AA seq 343 aa AA seqDB search
MNREQATFLTSFLGTFSALAIGFHFVRDKLREAGYDPARLILIGLDDQVTEKQPGDKVMA
SYLESNYAQMVAIALAVATTTLVYMKFFSNSKRKPILSPQVWQEFPLKEKIIISPNTAIY
RFALPRPDDVLGLPIGQHISISAEINGKDIMRSYTPTSSDDDLGHFDLLVKAYEKGNISR
YISLLKVGDKIRVRGPKGFFKYGPSLSRELGMIAGGTGITPMLQIIRAALKNPLDRTKLS
LIYANVNFEDILLKKELDDLAAAHPNRFQVYYVLNNPPEGWTGGVGFVSKDQVEKFMPPT
DDNIKVLMCGPPPMMNAMKKHLSELNYSAPRTISKLDDQVFLF
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgagaacaggcgacgtttcttacctctttcttgggcactttctctgccttggcc
ataggcttccatttcgttcgggacaagcttagagaagcaggctacgaccccgcacgactc
attcttattggattagacgaccaagttaccgagaaacaaccaggcgacaaagtcatggct
tcttacctcgagagcaactatgcccaaatggtcgccatcgctctggcggtggccaccacc
acactcgtttacatgaagttcttctccaactctaagagaaaacccatcctcagccctcag
gtctggcaagagttcccgctcaaggagaaaatcattatttctcccaacactgctatttac
cggttcgctcttccccggcctgacgatgttctaggcctccccattggccagcacatctcc
atctccgctgagatcaacggcaaggacatcatgcgcagctacacccctaccagcagtgac
gatgacctcggccactttgatctccttgtcaaggcttatgagaagggtaacatttcccgg
tacatttccctcctcaaagttggcgacaagatacgcgtccgtggacccaagggcttcttc
aaatacggcccttctctgtcgcgcgagctgggaatgattgctggcggcactggcatcacg
cctatgttacagatcatccgtgcagcgctcaagaaccctcttgatcgtactaagctgagc
ctcatatatgccaacgtcaactttgaggacattctcctgaagaaggagcttgatgacttg
gccgccgcacaccccaaccgtttccaagtttactacgtccttaacaaccctcctgagggc
tggactggcggcgtcggcttcgtctccaaggaccaggtcgagaagtttatgccacccacc
gacgacaacatcaaagtacttatgtgtggaccccctcctatgatgaacgctatgaagaag
catttgtcggagctcaactactctgctcctcggactatcagcaaacttgatgatcaggtc
ttcttgttctaa

DBGET integrated database retrieval system