KEGG   Cryptosporidium parvum: cgd1_1370Help
Entry
cgd1_1370         CDS       T00168                                 

Definition
protein with 3x EFh domains
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cpv  Cryptosporidium parvum
Brite
Protein phosphatases and associated proteins [BR:cpv01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     cgd1_1370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
1
AA seq 189 aa AA seqDB search
SFCTKLIAKLMLRNESSGISEQEKLELVHAASFTRRDIIRIYSRFKALDTNQNGELDPHE
LFEMPEIADNPLVKRVISIFDTNKDGKVSFVEFIIGLARLAVGSNPEEKMKFAFDIYDVN
SDGWISNGELFKVMKIMVGDNLEDLQLQQLVDRCIIQADKDGDGLISYEEFCEMVAHLDI
NTKLNLQFQ
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
tctttttgcacgaaattaatcgccaaactaatgcttagaaatgaatcaagtggtatttca
gagcaggaaaagcttgagctagtacacgctgcgagctttaccagaagagatattattcgt
atatactctagattcaaggcactagatactaatcaaaatggggagcttgacccacacgag
cttttcgaaatgccagaaattgcagataatccattagtcaagcgtgtgatttctattttt
gacactaataaggacggtaaagtatcatttgttgaattcattataggtcttgcaaggtta
gctgttgggagtaatccggaagagaagatgaagtttgcttttgatatctatgatgtgaat
agtgatggctggatttcaaatggggagctttttaaggttatgaaaataatggttggagat
aatttggaggatttacaacttcaacaattggttgataggtgcataattcaagcagataaa
gacggagatgggctcatttcttatgaagaattttgtgaaatggttgcccatcttgatatt
aataccaaactcaatttgcaatttcag

DBGET integrated database retrieval system