KEGG   Cryptosporidium parvum: cgd1_290Help
Entry
cgd1_290          CDS       T00168                                 

Definition
Ub6p like ubiquitin at N-terminus and ubiquitin C terminal hydrolase at the C-terminus
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
cpv  Cryptosporidium parvum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
1
AA seq 499 aa AA seqDB search
TQVIINIKLNAMEQIKVTVKWNVKTFEDVDLVFSSPLSEFRERLSNLTGVPASKQKLMSQ
RGVLRDGMDLNKLGLKPGSKIVLVGTAEGGELKAPSEKTIFFEDLTSDERAKILHEKEIV
PLPVGLENLGNTCYLNSIIHMLRSIPSFLQILRNSNLSSSERTSSSSGNSIKFLNSFKQL
MDKMDGSIERVVPGECVDLFRRQFPQYSTTTGGAFAMYQQQDAEEVLGSLLTLFRNELDG
KDGDDQTIGDIFRFRMKTKFKNTALETDEEVKMEENYKLMCHMGTQLNPVDFLTQGIKLS
LDEKVEKKSSETGIDSIYQKTSEIDSLPPYLLVQLVRFEWKKSSEIARTEATRAKVCRKI
EFSQNLDLYEFCSEDLKKILNIGRDISEKKKSKAIEKPDQEEQKMETELYTDCPTGVYEL
ECVVTHQGRTADSGHYVAWRYCPNDREYIIKFDDDKVSRIKAKDADLSGGRSDYHIAVML
LYKKTVIKASEEEMATLLS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
acacaagtaataattaatattaagttaaatgcaatggagcaaataaaagtaacagtcaag
tggaacgtgaaaacctttgaagatgttgatcttgttttttcaagtcctctttctgagttt
agggagaggttaagcaatttgacaggggtacctgcttctaagcagaaattaatgtcccaa
agaggtgtattaagagatgggatggatttaaataagcttggtttaaagcctggatcaaag
atagttcttgtgggtactgcagaaggaggtgaattgaaggctccatcagagaaaactata
ttttttgaggacttaacttcggatgaaagggcaaagatcttgcatgaaaaggaaatagta
cctcttccagtaggcctagagaatctgggaaatacgtgctatttaaattcaataattcat
atgttgagaagtatccctagttttttacagattttgagaaatagcaatttgagctcatct
gaaagaacaagttcaagttcaggaaattcaattaaatttctcaattcgtttaaacagtta
atggacaagatggacggaagcattgaaagagtggttccaggagagtgtgttgacttattt
aggcgtcagttcccccaatacagtacaacaactggaggagcttttgcgatgtaccaacaa
caagatgcagaggaagttttgggaagtttgcttacattgtttagaaacgagctagacgga
aaagatggagacgatcagacaataggggatatatttcgttttagaatgaaaactaaattt
aaaaatactgcattagagactgacgaggaagttaaaatggaggagaattataagcttatg
tgtcatatgggaactcaattgaatcctgtagacttcttaactcaaggtattaagctctca
ttagatgagaaagttgagaagaaatcttctgaaacaggtatcgactctatttatcaaaaa
acttcggaaatagattctttgccaccatatttacttgtacagcttgtacgatttgaatgg
aaaaaatctagtgagattgcaagaacagaggctactagagcaaaagtatgtagaaagatt
gagttttcccaaaatttagatctttatgaattttgctctgaagatttaaaaaaaatcctt
aatattggaagagatatctcagagaaaaagaagagtaaagccatagagaagcctgatcaa
gaagaacagaaaatggagacagagttatatacagattgtcctacaggagtatatgaactc
gaatgcgtagttactcaccaaggtcgtactgccgacagtgggcattacgttgcttggaga
tattgtccaaatgatcgagaatacattattaaatttgatgacgacaaggtctcgagaata
aaagccaaggatgcagatctttcaggtggtagatctgactaccacatagctgtaatgctt
ttatacaaaaaaacagtaattaaggcttcagaagaggagatggccacattattaagttag

DBGET integrated database retrieval system