KEGG   Cryptosporidium parvum: cgd1_290Help
Entry
cgd1_290          CDS       T00168                                 

Definition
Ub6p like ubiquitin at N-terminus and ubiquitin C terminal hydrolase at the C-terminus
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
cpv  Cryptosporidium parvum
Brite
Enzymes [BR:cpv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     cgd1_290
Peptidases [BR:cpv01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   cgd1_290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
1
AA seq 499 aa AA seqDB search
TQVIINIKLNAMEQIKVTVKWNVKTFEDVDLVFSSPLSEFRERLSNLTGVPASKQKLMSQ
RGVLRDGMDLNKLGLKPGSKIVLVGTAEGGELKAPSEKTIFFEDLTSDERAKILHEKEIV
PLPVGLENLGNTCYLNSIIHMLRSIPSFLQILRNSNLSSSERTSSSSGNSIKFLNSFKQL
MDKMDGSIERVVPGECVDLFRRQFPQYSTTTGGAFAMYQQQDAEEVLGSLLTLFRNELDG
KDGDDQTIGDIFRFRMKTKFKNTALETDEEVKMEENYKLMCHMGTQLNPVDFLTQGIKLS
LDEKVEKKSSETGIDSIYQKTSEIDSLPPYLLVQLVRFEWKKSSEIARTEATRAKVCRKI
EFSQNLDLYEFCSEDLKKILNIGRDISEKKKSKAIEKPDQEEQKMETELYTDCPTGVYEL
ECVVTHQGRTADSGHYVAWRYCPNDREYIIKFDDDKVSRIKAKDADLSGGRSDYHIAVML
LYKKTVIKASEEEMATLLS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
acacaagtaataattaatattaagttaaatgcaatggagcaaataaaagtaacagtcaag
tggaacgtgaaaacctttgaagatgttgatcttgttttttcaagtcctctttctgagttt
agggagaggttaagcaatttgacaggggtacctgcttctaagcagaaattaatgtcccaa
agaggtgtattaagagatgggatggatttaaataagcttggtttaaagcctggatcaaag
atagttcttgtgggtactgcagaaggaggtgaattgaaggctccatcagagaaaactata
ttttttgaggacttaacttcggatgaaagggcaaagatcttgcatgaaaaggaaatagta
cctcttccagtaggcctagagaatctgggaaatacgtgctatttaaattcaataattcat
atgttgagaagtatccctagttttttacagattttgagaaatagcaatttgagctcatct
gaaagaacaagttcaagttcaggaaattcaattaaatttctcaattcgtttaaacagtta
atggacaagatggacggaagcattgaaagagtggttccaggagagtgtgttgacttattt
aggcgtcagttcccccaatacagtacaacaactggaggagcttttgcgatgtaccaacaa
caagatgcagaggaagttttgggaagtttgcttacattgtttagaaacgagctagacgga
aaagatggagacgatcagacaataggggatatatttcgttttagaatgaaaactaaattt
aaaaatactgcattagagactgacgaggaagttaaaatggaggagaattataagcttatg
tgtcatatgggaactcaattgaatcctgtagacttcttaactcaaggtattaagctctca
ttagatgagaaagttgagaagaaatcttctgaaacaggtatcgactctatttatcaaaaa
acttcggaaatagattctttgccaccatatttacttgtacagcttgtacgatttgaatgg
aaaaaatctagtgagattgcaagaacagaggctactagagcaaaagtatgtagaaagatt
gagttttcccaaaatttagatctttatgaattttgctctgaagatttaaaaaaaatcctt
aatattggaagagatatctcagagaaaaagaagagtaaagccatagagaagcctgatcaa
gaagaacagaaaatggagacagagttatatacagattgtcctacaggagtatatgaactc
gaatgcgtagttactcaccaaggtcgtactgccgacagtgggcattacgttgcttggaga
tattgtccaaatgatcgagaatacattattaaatttgatgacgacaaggtctcgagaata
aaagccaaggatgcagatctttcaggtggtagatctgactaccacatagctgtaatgctt
ttatacaaaaaaacagtaattaaggcttcagaagaggagatggccacattattaagttag

DBGET integrated database retrieval system