KEGG   Cryptosporidium parvum: cgd1_3040Help
Entry
cgd1_3040         CDS       T00168                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cpv  Cryptosporidium parvum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cgd1_3040
   01230 Biosynthesis of amino acids
    cgd1_3040
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cgd1_3040
   00051 Fructose and mannose metabolism
    cgd1_3040
   00562 Inositol phosphate metabolism
    cgd1_3040
Enzymes [BR:cpv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     cgd1_3040
Exosome [BR:cpv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   cgd1_3040
  Exosomal proteins of bladder cancer cells
   cgd1_3040
  Exosomal proteins of melanoma cells
   cgd1_3040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
1
AA seq 250 aa AA seqDB search
MSRKYFVGGNFKCNGTKESLKTLIDSFKQVESSNSEVYVFPTSLHISLVKEFFGNDHPGV
FKIGSQNISCTGNGAFTGEVSCEMLKDMDVDCSLVGHSERRQYYSETDQIVNNKVKKGLE
NGLKIVLCIGESLSERETGKTNDVIQKQLTEALKDVSDLSNLVIAYEPIWAIGTGVVATP
GQAQEAHAFIREYVTRMYNPQVSSNLRIIYGGSVTPDNCNELIKCADIDGFLVGGASLKP
TFAKIIESAQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtctagaaagtactttgtgggtggtaacttcaagtgcaatggcacaaaagaatctcta
aagactctgattgattctttcaaacaagtggaatcaagtaattcagaggtttacgtattc
ccaacttcactacatatttcattggtcaaagagtttttcggtaatgatcatccaggagta
ttcaagattggatcacagaacatttcttgtactggaaacggagcatttacgggagaagtt
tcttgtgaaatgcttaaagatatggatgttgattgttctttagtaggccattctgaaaga
agacaatactattcagaaactgatcaaatcgtaaataataaggtaaagaagggtttggag
aatggcctgaagattgttctttgtattggagagtcattaagtgagagagaaacaggaaag
accaatgatgtcatacagaagcagttaacggaagctttaaaggatgtgagtgatttgtct
aacttagtaatagcttacgagccaatttgggctatcggaacaggagtagtagcaacacct
gggcaagctcaagaggctcatgcatttattagagaatatgttacaaggatgtataatccc
caggtatcttccaatttaagaataatttatggaggatcggtcactcctgataattgtaat
gaattaatcaaatgcgccgatattgatggtttccttgttggaggagcttcattgaagcca
acatttgcgaaaatcattgaatctgcacagtaa

DBGET integrated database retrieval system