KEGG   Cryptosporidium parvum: cgd1_3040Help
Entry
cgd1_3040         CDS       T00168                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cpv  Cryptosporidium parvum
Pathway
cpv00010  Glycolysis / Gluconeogenesis
cpv00051  Fructose and mannose metabolism
cpv00562  Inositol phosphate metabolism
cpv01100  Metabolic pathways
cpv01110  Biosynthesis of secondary metabolites
cpv01130  Biosynthesis of antibiotics
cpv01200  Carbon metabolism
cpv01230  Biosynthesis of amino acids
Module
cpv_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cgd1_3040
   00051 Fructose and mannose metabolism
    cgd1_3040
   00562 Inositol phosphate metabolism
    cgd1_3040
Enzymes [BR:cpv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     cgd1_3040
Exosome [BR:cpv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   cgd1_3040
  Exosomal proteins of bladder cancer cells
   cgd1_3040
  Exosomal proteins of melanoma cells
   cgd1_3040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 3371710
NCBI-ProteinID: XP_628120
ApiDB_CryptoDB: cgd1_3040
UniProt: Q5CSE7
Structure
PDB: 

Jmol
Position
1
AA seq 250 aa AA seqDB search
MSRKYFVGGNFKCNGTKESLKTLIDSFKQVESSNSEVYVFPTSLHISLVKEFFGNDHPGV
FKIGSQNISCTGNGAFTGEVSCEMLKDMDVDCSLVGHSERRQYYSETDQIVNNKVKKGLE
NGLKIVLCIGESLSERETGKTNDVIQKQLTEALKDVSDLSNLVIAYEPIWAIGTGVVATP
GQAQEAHAFIREYVTRMYNPQVSSNLRIIYGGSVTPDNCNELIKCADIDGFLVGGASLKP
TFAKIIESAQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtctagaaagtactttgtgggtggtaacttcaagtgcaatggcacaaaagaatctcta
aagactctgattgattctttcaaacaagtggaatcaagtaattcagaggtttacgtattc
ccaacttcactacatatttcattggtcaaagagtttttcggtaatgatcatccaggagta
ttcaagattggatcacagaacatttcttgtactggaaacggagcatttacgggagaagtt
tcttgtgaaatgcttaaagatatggatgttgattgttctttagtaggccattctgaaaga
agacaatactattcagaaactgatcaaatcgtaaataataaggtaaagaagggtttggag
aatggcctgaagattgttctttgtattggagagtcattaagtgagagagaaacaggaaag
accaatgatgtcatacagaagcagttaacggaagctttaaaggatgtgagtgatttgtct
aacttagtaatagcttacgagccaatttgggctatcggaacaggagtagtagcaacacct
gggcaagctcaagaggctcatgcatttattagagaatatgttacaaggatgtataatccc
caggtatcttccaatttaagaataatttatggaggatcggtcactcctgataattgtaat
gaattaatcaaatgcgccgatattgatggtttccttgttggaggagcttcattgaagcca
acatttgcgaaaatcattgaatctgcacagtaa

DBGET integrated database retrieval system