KEGG   Cryptosporidium parvum: cgd1_3300Help
Entry
cgd1_3300         CDS       T00168                                 

Definition
ring domain protein
Orthology
K10842  
CDK-activating kinase assembly factor MAT1
Organism
cpv  Cryptosporidium parvum
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    cgd1_3300
  Replication and repair
   03420 Nucleotide excision repair
    cgd1_3300
Transcription machinery [BR:cpv03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     cgd1_3300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
1
AA seq 296 aa AA seqDB search
MNEDIWKDGQKQYSCPLCMTSTYYKNDIKMYYGDPCGHKFCSECSTKANNNKKSTSILRG
SNQICPVCHGFVKYIADFEYGETDFLKFESQARKQVYTILNETRKDFKDTPCYDNYLEKR
EDLIYKLIYGNDTEKKSTQDFLNQYSKENQVAILDRKTREETLLRNDILEIVQKEGTFYE
QLNQLSQNTTIDHLQIVHPLQNEYPEFFQNFNKNSNNQNNSNNQNIALGSNIPNPIDKNI
TCKEYLHQNAKKSNVSTYSSIESKQRAGGFTENIVWSLCKNELFFGFYACHHDSNP
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagatatttggaaagatggtcaaaaacaatattcttgcccattatgtatgaca
agtacatattataagaatgatatcaaaatgtactatggtgatccatgtggacataaattt
tgttcagaatgttcaacaaaagcaaataataataaaaaatcaacaagtatattaagagga
agtaatcaaatatgtccagtatgtcatggttttgttaaatatattgcagattttgaatat
ggcgagacagattttttaaaatttgaaagtcaagcaagaaaacaggtatatacaatatta
aatgaaacaagaaaagattttaaagatactccttgttatgataattatcttgagaaacgt
gaagatttaatatataaattaatttatggaaatgatacagaaaagaaatcaacacaagat
ttcttaaatcaatattcaaaagaaaatcaagttgctatattagatagaaaaactagagaa
gaaactcttttaagaaatgatattcttgaaattgtacaaaaagaaggtactttttatgag
caacttaatcaactttctcaaaataccacaattgatcatcttcaaattgtacacccactt
caaaatgaatatcctgaattctttcaaaattttaataaaaattctaacaatcaaaacaat
tctaataatcaaaatattgctcttggtagtaacattcctaatcctatcgacaagaatatt
acatgcaaggaatatctacatcaaaatgctaagaaatcaaatgtttcaacatattcatcc
attgaatctaaacaacgtgcaggaggatttactgaaaatattgtatggagtttgtgtaaa
aatgagctcttttttgggttttatgcttgtcatcatgattctaatccgtaa

DBGET integrated database retrieval system