KEGG   Cryptosporidium parvum: cgd1_3300Help
Entry
cgd1_3300         CDS       T00168                                 

Definition
ring domain protein
Orthology
K10842  
CDK-activating kinase assembly factor MAT1
Organism
cpv  Cryptosporidium parvum
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:cpv03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:cpv03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
1
AA seq 296 aa AA seqDB search
MNEDIWKDGQKQYSCPLCMTSTYYKNDIKMYYGDPCGHKFCSECSTKANNNKKSTSILRG
SNQICPVCHGFVKYIADFEYGETDFLKFESQARKQVYTILNETRKDFKDTPCYDNYLEKR
EDLIYKLIYGNDTEKKSTQDFLNQYSKENQVAILDRKTREETLLRNDILEIVQKEGTFYE
QLNQLSQNTTIDHLQIVHPLQNEYPEFFQNFNKNSNNQNNSNNQNIALGSNIPNPIDKNI
TCKEYLHQNAKKSNVSTYSSIESKQRAGGFTENIVWSLCKNELFFGFYACHHDSNP
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagatatttggaaagatggtcaaaaacaatattcttgcccattatgtatgaca
agtacatattataagaatgatatcaaaatgtactatggtgatccatgtggacataaattt
tgttcagaatgttcaacaaaagcaaataataataaaaaatcaacaagtatattaagagga
agtaatcaaatatgtccagtatgtcatggttttgttaaatatattgcagattttgaatat
ggcgagacagattttttaaaatttgaaagtcaagcaagaaaacaggtatatacaatatta
aatgaaacaagaaaagattttaaagatactccttgttatgataattatcttgagaaacgt
gaagatttaatatataaattaatttatggaaatgatacagaaaagaaatcaacacaagat
ttcttaaatcaatattcaaaagaaaatcaagttgctatattagatagaaaaactagagaa
gaaactcttttaagaaatgatattcttgaaattgtacaaaaagaaggtactttttatgag
caacttaatcaactttctcaaaataccacaattgatcatcttcaaattgtacacccactt
caaaatgaatatcctgaattctttcaaaattttaataaaaattctaacaatcaaaacaat
tctaataatcaaaatattgctcttggtagtaacattcctaatcctatcgacaagaatatt
acatgcaaggaatatctacatcaaaatgctaagaaatcaaatgtttcaacatattcatcc
attgaatctaaacaacgtgcaggaggatttactgaaaatattgtatggagtttgtgtaaa
aatgagctcttttttgggttttatgcttgtcatcatgattctaatccgtaa

DBGET integrated database retrieval system