KEGG   Cryptosporidium parvum: cgd1_3710Help
Entry
cgd1_3710         CDS       T00168                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cpv  Cryptosporidium parvum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cgd1_3710
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cgd1_3710
   00620 Pyruvate metabolism
    cgd1_3710
   00640 Propanoate metabolism
    cgd1_3710
Enzymes [BR:cpv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     cgd1_3710
Lipid biosynthesis proteins [BR:cpv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   cgd1_3710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
1
AA seq 695 aa AA seqDB search
MSDKRPRSPCSNNNDELNDSSVLTENMDTVATRSKNLPFHETYKSKPTPADKPYRVDGID
KYKELYEQSIRDPEGFWSQMARKELRWLRDFTKVRSSGTCLQDRLAWFLNGKLNVCDNCV
DRWAEIQPNTTALIWEGDDPSSIRHISYIELFRNVCKMANVLKRFGIKKGDSVGIYMPMI
PETIYTMLACARIGAVHMVVFAGFAAQNLLERLVNARCKIVVTADQGSRGKKIINLKDVV
DKALEKIPEIKTCIVFRHLNGPIEFVKGRDFDGETLMRSEKPYCPLEDMDSEDPLFYLYT
SGSTGTPKGVQHSTAGYLLYAAVTQKYLFNIHPGDIFGCAGDIGWITGHSYLVYAPLCNG
ITTLIFEGVPTYPNAGRYWEMVERHRITHFYAAPTAIRTLKRLGDDFVKKHDRSSLRVLG
SVGEPINPSAWRWYHSVVGEERCSIVDTYWQTETGGIVIAPIPGCFDTKPGSATFPFFGI
EPAILDPDTGKEIDGPGSGVLCIKNSWPGMFRGIFGAHYLHEDLYTKPFPGYYFTGDGVL
RDQDGYLWITGRIDDTINVSGHRLSSKEIEDALTNHFGIAEAAAVAIDHDVKGNALVCFV
VLKDSGNRTFDLNNSSPHPFEYELRMCVRTQIGPVATPDHIIVVENIPKTRSGKVVRRLL
RKIATGCNDYGDISTVANPECIKSIESSWAQYLKR
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataaaagacctagatcgccatgttctaacaataatgatgaattaaatgattca
tcagtacttactgagaacatggataccgttgcaactcgttccaagaacttgccatttcac
gaaacatacaaatcaaaaccaactcctgctgataagccttatagagtagatgggattgat
aaatataaagaactctacgaacaaagtattagagatcctgagggtttttggagccaaatg
gctagaaaagaacttcgatggctaagagattttactaaagtaaggagttctggtacttgt
cttcaagatagacttgcttggtttttgaatggaaagttaaatgtatgcgataattgcgta
gatagatgggctgaaatacaaccaaatactactgcattaatttgggaaggagatgatcca
tcatctattagacatattagctatattgaactgtttagaaacgtttgtaaaatggccaat
gttttgaaacgatttggtatcaaaaaaggtgattctgttggtatttatatgccaatgata
cctgaaactatatatactatgttagcttgcgctagaataggagctgtacatatggtagtt
tttgctggatttgcagctcagaatcttcttgagagacttgttaatgctagatgtaaaata
gtagtaactgcagatcaaggatccagaggtaagaagattattaacttgaaagatgttgtt
gataaagctcttgaaaagattcctgagattaaaacatgcattgtttttagacacttgaat
ggacctattgaatttgtcaagggaagagattttgatggagaaactttaatgagatctgaa
aaaccttattgtcctttagaagacatggatagtgaggatccactattttatttatatacc
tcaggtagtactggaactccaaaaggtgttcaacactctactgcaggatacttactttat
gctgctgttacacaaaagtacttattcaacattcatcctggggatatttttggatgtgct
ggagatattggttggattactggccactcttacttggtatatgctcctctttgtaatggt
ataaccactttaatttttgagggagtaccgacttatcctaatgctgggagatactgggaa
atggtggagagacacagaattactcatttttacgctgctccaactgcaatcagaactctt
aaacgccttggagatgattttgttaaaaaacacgatagatcatcattgagagttctagga
tcagttggagagcctattaatccctctgcatggagatggtaccattcagttgttggtgaa
gagagatgttctatagttgatacttattggcaaactgagacaggaggaattgttattgct
ccaattcctggttgttttgatactaaacctggttcagcaacatttcccttctttggtatt
gagcctgcgatacttgatcctgatacaggaaaagaaattgatggaccagggtctggagtt
ctttgtataaaaaactcatggccaggtatgtttagaggtatttttggagctcattatctt
catgaagatctttatacaaaaccattccccggatactattttactggggatggtgtttta
agagatcaggatggatatctttggattactggtagaattgacgatacaattaatgtttct
ggtcatagactaagctctaaggaaattgaagatgctcttaccaaccattttggcattgca
gaagctgcagctgttgcaattgatcatgatgttaaaggtaatgctcttgtttgctttgta
gttttaaaggattctggtaatagaacttttgacttgaataattcaagtcctcatcctttt
gaatatgaacttaggatgtgtgtcaggacccaaatcggccctgtggcaacacctgatcat
attattgttgttgagaatatccctaaaacaagatcaggaaaagttgtaagacgtcttctt
agaaagattgctactggttgcaatgactatggagatatttcaacggttgcaaatcctgag
tgtattaaatccattgagtcatcctgggcacaataccttaagagataa

DBGET integrated database retrieval system