KEGG   Cryptosporidium parvum: cgd2_2060Help
Entry
cgd2_2060         CDS       T00168                                 

Definition
possible transcription factor TFIIH
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
cpv  Cryptosporidium parvum
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    cgd2_2060
  Replication and repair
   03420 Nucleotide excision repair
    cgd2_2060
Transcription machinery [BR:cpv03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     cgd2_2060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
2
AA seq 709 aa AA seqDB search
MSIERPFDYKTSSLSSWNLQEYIATLSSTNTCLLFEDISCVTELFSSLSEIQQNIVSRLM
ILGNGYGNYIGEQAMNIWILTTKRNELEYAIRKLRSLKIIKVNVLDSNSQKSSSDSISVQ
YQLNPIFQKTLSKFLYEGDISIGFEMPKRKSEIKISYESLTKFVRKQWSNILNIIVQLSG
SQNVPKNSANTFYKFKLISPDTIKVLDNIQLISCDIGKYNKRNSSNSKGLRIQIDSSLSQ
ESNEQLFDGFDQEDRFGSQNDQNALDIYNEIKYGMAGSNSNSEEEYLPTNNLKIKPKKRV
ISAKHTLAKNQVDKIFEQKLTPKAFCWLLCDSCNQLLMLLNGFIKLVELESNIENGEYNF
SQINSENILNPTITNVISLIMRISSSKVGQPISIHKKTNNNILMRFVLFAYDLGLLYFDE
SIIESSLYSLKNRFENLRDLNIELLYTTPFSLLIGSEGLKLQSLYSAFKIDDNLIQKSDP
ENIQNFLLPSHFYFDEELWHKSTTETSNVKINEPNCLSMNSTRLEAGIIVQSNFRIYCYT
ASPLQAKILRHLCQVKVRGPNIICGILTRKGLLSAYSMGVSAEQILRFFSSNAHPIILRR
FMLEGTSIIPVNVETQLKLWEKDKNRLKISHASTFSDWGASPNDIQLFRQTILYARSKDI
LLYNSPIELTEKELNLNVELQKKIILVIKQEYEDDIKTFIRTKREVINK
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatagagagaccttttgattataaaacttcatctctttcatcatggaatttacaa
gaatacatagcaactttgtctagcacgaatacatgcctattatttgaagatatttcttgt
gtaactgaattattttcgtccctttctgagatacaacagaatattgtatctagacttatg
attttgggaaatggatatggaaattacataggagaacaagctatgaatatatggatactt
acaacaaaaagaaatgaattggaatatgcaattaggaaattaagatcattaaaaataatt
aaagtcaatgtactagattctaactcccaaaaaagttcatctgattctatttctgtgcaa
taccaattaaacccaatatttcaaaaaactttatctaaatttttgtatgaaggggatata
tctattggatttgaaatgccaaagagaaaatccgagataaagatctcgtatgaatctctc
acgaagtttgtaagaaaacaatggagtaatattttgaatattattgttcaattaagcggg
agtcaaaatgttccaaaaaatagtgctaatacattttataaattcaaattaatttccccg
gacacaataaaagttctggataatatccaattaatttcttgcgatattgggaaatacaac
aaaagaaattcttctaattcaaagggacttagaattcaaattgatagtagtttatctcaa
gaaagtaatgaacagttatttgatggttttgatcaagaggatagatttggatctcaaaat
gaccaaaatgcactagacatatacaacgagataaaatatggtatggctggaagcaattct
aacagtgaagaagaatatttgccaaccaataatttaaaaattaaaccaaagaagagagtt
attagtgccaaacatacccttgcaaaaaaccaagttgataaaatatttgaacagaagttg
acaccaaaagctttttgttggttactttgtgatagctgtaatcaattgttaatgcttctt
aatggatttataaaattagtagagcttgagtcaaacattgaaaatggagaatacaatttt
agtcaaataaacagtgaaaatatactaaacccaacaattacaaatgtaataagtctaata
atgcgtatttcaagttcaaaagttggccagccaatttcaatacataagaaaacgaataat
aatattttgatgcgatttgttttgtttgcatatgatttaggactgctctattttgatgaa
tctattattgagagtagtctatattctttgaaaaatagattcgaaaatcttcgtgattta
aatattgaattattgtacactactcctttttcattgttgattggctctgagggtctgaaa
cttcaaagtttatactctgcatttaaaattgatgacaacttgattcaaaaaagtgacccc
gaaaatatccaaaattttcttcttccatcacatttttattttgacgaagaattatggcat
aaatcaacaactgaaacaagcaatgtaaaaataaacgaacctaactgtttgagtatgaac
tctactcgtctcgaggcaggaattattgttcaaagtaactttaggatttactgttataca
gcatctccattacaagccaagattcttagacatctatgtcaagttaaggttcgtggccca
aacatcatttgtggaatattgactaggaaaggcttgttatccgcatattcaatgggagtg
tcagctgaacaaatacttagatttttttccagcaacgcgcatccaataatattaaggcga
tttatgttagaaggaacgagtattatacctgtgaatgtagaaacgcagttgaaactatgg
gagaaagacaaaaatagactcaaaatttcccatgcaagcaccttttcagactggggagca
agccctaacgatattcagctatttagacaaacgatactctatgcaagaagtaaagacata
ttactttacaattcccccattgaattaacagaaaaagaactaaacttaaatgttgaatta
caaaaaaagattatattagttataaaacaggaatatgaagatgatattaagacttttatt
cgaacaaaaagagaagttattaataaataa

DBGET integrated database retrieval system