KEGG   Cryptosporidium parvum: cgd2_2130Help
Entry
cgd2_2130         CDS       T00168                                 

Definition
pyrophosphate-dependent phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cpv  Cryptosporidium parvum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:cpv01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cpv01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cpv00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cpv00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cpv00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cpv00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
2
AA seq 1426 aa AA seqDB search
MFLNGEMNRSQRNAIRRLRSLAVILEDTHIDKERSIPLISKAITSQKHIRRRDSIERNIA
TRLDSFKLSMGGKPHLHSADLFENFSPVQLERQKWVPTLPYSLSSNCIKIKEIEIPDLIQ
KDENKLKELLPNTFGRPCIEITRDESKNSENSDHALRVGIVLSGGPAPGGHNVICGVYDF
IKNHHPDSQLFGFLGGLDGLFKSTYKVISDELMDRFRNQGGFDMLWSGRGRINGEQDLER
VEKVCEQLQLHGLIVIGGDGSNSNAALIADYMAKKNKNFCIVGVPKTIDGDLKNPAIEVS
FGFDTAARTYAECVGNLCSDICTSQNVYHFVRVMGRSASHLALEVALQTRPNIVFIAEEV
EQEGITLFEIVKNIVDLMEERSKMGKMYGIILIPEGLIEFIPEMKILIQELNEILDKLKY
EGSECDQEASPDDFDKKICSCLSESSAKIWEYLPENIREQLLLDREATGQIQVAKIATER
LLILLVEAELHRRHGTSFYYDFEHGQTKETISDQVEISNKSNGSILMPFGFTMMHHYLGY
EGRCAMPSNFDSNYCYALGHCAGALVYKGMNGYLAVIRGLEGNPLSWQACGISITRIMEV
KKSRQDGQCYAAVTRQLVDLNGPLFKLLKQVRDIWKFQDLYRAPGPLQFEGPCSETIPYI
VRTPELQDLLCGEDASVTDTDINIVQPNNGGGKRGVFNRIQGTLSSLQLYRTTYRPPLPL
LLTHLKARCKPTTQYNLSDPLIKRQITTCYPHLCNSNHFYCQEAQLDISSEEPNVGLRIG
VLLMSRQAPGIANVVWGLYHRLKMVRGRCLGFYGVKGFLQGKHITLTEKDVDLLPNQGGS
ELIGRTYTECLVSKENLEKARKVCESLHLDGLVLCGSAFGMTQGAILAEYFLQNNCNTKV
VGVPATASNNLANDLVEACVGFDSSTKLYASLIGNVLTDAASMPKYWHFIRLMGRQPSNE
VLECALQTHPNVVIIAEEYGAADKTLVHIVEDVADVICKRAEFGKNFGTVLIPDALLSHL
PDMKILISEINELRRFAEEHSEMKLFMSEMMSLGHSDHPTLSDHTNSQEKSSRVDVADNK
SSAANQEHSPTDSFDGSKYSSKMTPWSLALFKSLPRFIRREILSLDVDSAFSAIETEALL
VLMIKKELKKRKQDNKYNGNFQPFTHFFGYQGRSAMPSQFDAKLGYALGHFASIVVESGL
TGHLCSIRGLCGDVSDWRMTAIPFNCLMKIVPSNDETHPELPSNIPTIPSSEVDLKGKAY
RWLKIVQEHWAMQDRFCNPGPIQFDGAAANFYFRTLHEQQSEYYEMLKHVQNYAELVRET
CTFGVNESFLKTAFVTLNGLLNLRYRDGSLLSSLPDIGPIILQMKSNSGMLNNPTGQGET
IEPIASELSNKAASNLHTSKYISQNNLHMAQSICPGVEEGPWNKTK
NT seq 4281 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgaatggagaaatgaacagaagccaaagaaatgctattcgccggcttagaagt
ttggctgtaatacttgaagacactcatatcgataaagaacgtagtattccattaatttct
aaagcgataacgtctcaaaagcatattcgtagaagagattcaatagaacgtaatattgca
actaggttagactcatttaaattgtcaatgggtggaaaacctcatttgcactcagcagat
ctctttgaaaactttagtcccgtgcaattagaaagacaaaaatgggtgccaacattgcca
tattccttatcttcaaactgcataaaaataaaagagattgaaattcctgacttgatccaa
aaagatgagaataaactcaaagaattgttaccgaacacatttgggagaccatgcattgaa
ataactcgagatgaatcaaagaactcggagaattcagaccatgctcttagagttggaatt
gtattatcaggtggtcctgcacctggcggacataatgtcatttgcggtgtatatgatttt
attaagaatcatcaccctgatagccagctattcggatttttaggtgggttagatggtctt
ttcaaatcaacttataaggttatttcagatgaattaatggatcgatttagaaaccaagga
ggttttgatatgctttggtctggtagagggagaattaatggagagcaagatttggaaaga
gttgaaaaagtttgcgagcagcttcaattacatggattaattgttattggaggtgatggc
tcaaattcaaatgctgcgttgatcgcggattacatggcaaagaaaaacaaaaatttttgt
attgtaggggtcccaaaaactattgatggagatttaaaaaaccctgctattgaagtctct
tttggatttgatactgctgcgaggacttacgctgagtgcgtaggtaatctttgctcagac
atttgtacatcacaaaatgtctatcacttcgtaagagttatgggtagatcagcatcgcat
ttggctctggaagtcgcattgcaaacaagaccaaatattgttttcattgcagaagaagtt
gaacaagaaggaataacattatttgaaatagtgaagaatattgtagatttaatggaagag
cgttcaaaaatgggcaaaatgtatggcataatattaatacctgaaggcttaattgagttt
atcccagaaatgaaaattttaattcaagaattaaatgaaatccttgataagttaaagtat
gaggggtctgaatgcgatcaggaagcttcacctgacgactttgataaaaagatatgcagt
tgtctttcggagtcttctgcaaaaatttgggagtaccttccagaaaatattagagagcaa
ttgttacttgatagagaggctactggccaaatacaagttgcaaaaatagcaacagagaga
ttacttatactacttgttgaagcagagttacataggaggcatggaacatctttctattat
gattttgaacatggccaaaccaaggaaacaatttcagatcaggtagaaatttcaaataag
tcaaatggctcaatactgatgccttttggatttacaatgatgcatcattatttgggttat
gaaggaagatgcgccatgccatctaattttgattctaactattgttacgcactgggccat
tgcgcaggagcgttggtttataaaggtatgaatggttacttggcagttataagaggatta
gaagggaatcctcttagttggcaagcatgcggtataagtattactagaattatggaagtt
aaaaaatccagacaagacggtcagtgctatgctgcagttactcgtcagttagtcgatttg
aatgggccacttttcaaactattaaaacaggttcgagatatttggaagtttcaagattta
tatagggcgcctggacctttacaattcgaaggcccatgctctgaaactatcccttatatt
gtaagaacgccggagttacaagatttattatgcggagaggatgcctcagttacagatact
gatataaatattgtacaaccaaataatgggggagggaaaagaggtgtatttaatagaatt
cagggaaccctctcctctctccaactttatcgcacaacatatagacctccgttgccactg
ctacttacccaccttaaagcaagatgtaaaccgactactcaatataatttatctgatcct
ctgataaaaagacagattacaacctgttatcctcatttatgtaattcaaatcacttttat
tgccaagaagcgcaacttgacatttcatctgaagagcccaatgtagggttgagaatagga
gtattgcttatgtctagacaagcacctggaattgcaaatgtggtatggggactataccac
cgtctgaaaatggtaaggggaagatgtttgggcttttatggagttaaaggatttttgcaa
gggaagcatattacacttactgagaaagatgtagatcttttgccaaatcaaggaggatcg
gaattaattggaagaacgtatacagagtgtttagtttcgaaagagaatttggaaaaggct
agaaaggtttgtgaaagtttacatttggatggccttgtattgtgtggctctgcatttgga
atgacccagggcgcaatcttggcagagtattttctacaaaataactgtaatactaaggtt
gttggcgtcccagcaactgcgtctaacaacttagcaaatgatctagtagaggcatgcgta
gggtttgattcaagcactaaattgtatgcaagcttaattggaaatgtattaacggatgct
gcttcaatgcctaaatattggcattttattagattaatgggaaggcaaccttcaaatgaa
gttctggagtgcgcactacagacacatccaaatgttgtaataattgctgaagaatatgga
gcagctgataaaactcttgttcacatcgtagaagatgtggcagatgtaatatgtaagaga
gcggagtttggaaagaacttcggaactgtactcattccagatgcattactttcacattta
ccagatatgaagattttaatttctgaaataaatgaattacgaagattcgctgaagaacat
tccgagatgaaattatttatgtctgaaatgatgagtttgggacacagcgatcaccccaca
ttgtccgatcacacaaatagccaagaaaaaagctctcgcgtagatgtggctgataacaaa
agttcggctgcgaatcaggaacatagccctacagatagctttgatggaagtaaatactct
tctaaaatgactccctggagtctcgcattatttaagtcattacctaggttcattagaaga
gaaatactttcattagatgttgactctgcattttccgcgatagagaccgaggcacttctt
gttttaatgataaaaaaggagcttaagaaaagaaaacaagataataaatataatggcaat
tttcagccgtttacacacttttttggatatcagggtagatctgctatgccatcacagttt
gatgcaaagctagggtatgcgcttgggcattttgcttcgatagttgttgagagcggacta
acaggccatctttgttctattagagggttgtgcggcgatgtttccgattggagaatgaca
gcaataccatttaattgcctaatgaaaattgttccttccaacgatgagacccatcctgaa
ctcccaagcaacattcctacaattccttctagtgaagtggatctgaaaggtaaagcatat
cgttggttaaaaatcgttcaggaacattgggcaatgcaagaccgcttttgcaaccctggg
cctatacaatttgatggggctgctgcaaacttttatttcagaacacttcatgagcaacaa
tcagagtactatgagatgcttaagcatgtgcaaaattacgcggagttggttagagaaacg
tgcacatttggcgtaaatgagtcatttctgaaaactgcgtttgtaactctgaacggccta
cttaatctgcgctatcgtgatggaagtctactctcgtcgcttccagatattgggccgatt
atactacaaatgaaatctaattcgggaatgttaaacaatcctacaggtcaaggcgaaaca
atagaaccaatagccagtgagctctcaaacaaggctgcaagcaatctccatacgtcaaaa
tatatttcacaaaacaacctgcacatggcacagtcgatctgtcctggagtagaagagggg
ccatggaacaaaactaaatga

DBGET integrated database retrieval system