KEGG   Cryptosporidium parvum: cgd2_2130Help
Entry
cgd2_2130         CDS       T00168                                 

Definition
(RefSeq) pyrophosphate-dependent phosphofructokinase
  KO
K00895  
diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Organism
cpv  Cryptosporidium parvum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cgd2_2130
   00030 Pentose phosphate pathway
    cgd2_2130
   00051 Fructose and mannose metabolism
    cgd2_2130
Enzymes [BR:cpv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     cgd2_2130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ApiDB_CryptoDB: 
UniProt: 
Position
2
AA seq 1426 aa AA seqDB search
MFLNGEMNRSQRNAIRRLRSLAVILEDTHIDKERSIPLISKAITSQKHIRRRDSIERNIA
TRLDSFKLSMGGKPHLHSADLFENFSPVQLERQKWVPTLPYSLSSNCIKIKEIEIPDLIQ
KDENKLKELLPNTFGRPCIEITRDESKNSENSDHALRVGIVLSGGPAPGGHNVICGVYDF
IKNHHPDSQLFGFLGGLDGLFKSTYKVISDELMDRFRNQGGFDMLWSGRGRINGEQDLER
VEKVCEQLQLHGLIVIGGDGSNSNAALIADYMAKKNKNFCIVGVPKTIDGDLKNPAIEVS
FGFDTAARTYAECVGNLCSDICTSQNVYHFVRVMGRSASHLALEVALQTRPNIVFIAEEV
EQEGITLFEIVKNIVDLMEERSKMGKMYGIILIPEGLIEFIPEMKILIQELNEILDKLKY
EGSECDQEASPDDFDKKICSCLSESSAKIWEYLPENIREQLLLDREATGQIQVAKIATER
LLILLVEAELHRRHGTSFYYDFEHGQTKETISDQVEISNKSNGSILMPFGFTMMHHYLGY
EGRCAMPSNFDSNYCYALGHCAGALVYKGMNGYLAVIRGLEGNPLSWQACGISITRIMEV
KKSRQDGQCYAAVTRQLVDLNGPLFKLLKQVRDIWKFQDLYRAPGPLQFEGPCSETIPYI
VRTPELQDLLCGEDASVTDTDINIVQPNNGGGKRGVFNRIQGTLSSLQLYRTTYRPPLPL
LLTHLKARCKPTTQYNLSDPLIKRQITTCYPHLCNSNHFYCQEAQLDISSEEPNVGLRIG
VLLMSRQAPGIANVVWGLYHRLKMVRGRCLGFYGVKGFLQGKHITLTEKDVDLLPNQGGS
ELIGRTYTECLVSKENLEKARKVCESLHLDGLVLCGSAFGMTQGAILAEYFLQNNCNTKV
VGVPATASNNLANDLVEACVGFDSSTKLYASLIGNVLTDAASMPKYWHFIRLMGRQPSNE
VLECALQTHPNVVIIAEEYGAADKTLVHIVEDVADVICKRAEFGKNFGTVLIPDALLSHL
PDMKILISEINELRRFAEEHSEMKLFMSEMMSLGHSDHPTLSDHTNSQEKSSRVDVADNK
SSAANQEHSPTDSFDGSKYSSKMTPWSLALFKSLPRFIRREILSLDVDSAFSAIETEALL
VLMIKKELKKRKQDNKYNGNFQPFTHFFGYQGRSAMPSQFDAKLGYALGHFASIVVESGL
TGHLCSIRGLCGDVSDWRMTAIPFNCLMKIVPSNDETHPELPSNIPTIPSSEVDLKGKAY
RWLKIVQEHWAMQDRFCNPGPIQFDGAAANFYFRTLHEQQSEYYEMLKHVQNYAELVRET
CTFGVNESFLKTAFVTLNGLLNLRYRDGSLLSSLPDIGPIILQMKSNSGMLNNPTGQGET
IEPIASELSNKAASNLHTSKYISQNNLHMAQSICPGVEEGPWNKTK
NT seq 4281 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgaatggagaaatgaacagaagccaaagaaatgctattcgccggcttagaagt
ttggctgtaatacttgaagacactcatatcgataaagaacgtagtattccattaatttct
aaagcgataacgtctcaaaagcatattcgtagaagagattcaatagaacgtaatattgca
actaggttagactcatttaaattgtcaatgggtggaaaacctcatttgcactcagcagat
ctctttgaaaactttagtcccgtgcaattagaaagacaaaaatgggtgccaacattgcca
tattccttatcttcaaactgcataaaaataaaagagattgaaattcctgacttgatccaa
aaagatgagaataaactcaaagaattgttaccgaacacatttgggagaccatgcattgaa
ataactcgagatgaatcaaagaactcggagaattcagaccatgctcttagagttggaatt
gtattatcaggtggtcctgcacctggcggacataatgtcatttgcggtgtatatgatttt
attaagaatcatcaccctgatagccagctattcggatttttaggtgggttagatggtctt
ttcaaatcaacttataaggttatttcagatgaattaatggatcgatttagaaaccaagga
ggttttgatatgctttggtctggtagagggagaattaatggagagcaagatttggaaaga
gttgaaaaagtttgcgagcagcttcaattacatggattaattgttattggaggtgatggc
tcaaattcaaatgctgcgttgatcgcggattacatggcaaagaaaaacaaaaatttttgt
attgtaggggtcccaaaaactattgatggagatttaaaaaaccctgctattgaagtctct
tttggatttgatactgctgcgaggacttacgctgagtgcgtaggtaatctttgctcagac
atttgtacatcacaaaatgtctatcacttcgtaagagttatgggtagatcagcatcgcat
ttggctctggaagtcgcattgcaaacaagaccaaatattgttttcattgcagaagaagtt
gaacaagaaggaataacattatttgaaatagtgaagaatattgtagatttaatggaagag
cgttcaaaaatgggcaaaatgtatggcataatattaatacctgaaggcttaattgagttt
atcccagaaatgaaaattttaattcaagaattaaatgaaatccttgataagttaaagtat
gaggggtctgaatgcgatcaggaagcttcacctgacgactttgataaaaagatatgcagt
tgtctttcggagtcttctgcaaaaatttgggagtaccttccagaaaatattagagagcaa
ttgttacttgatagagaggctactggccaaatacaagttgcaaaaatagcaacagagaga
ttacttatactacttgttgaagcagagttacataggaggcatggaacatctttctattat
gattttgaacatggccaaaccaaggaaacaatttcagatcaggtagaaatttcaaataag
tcaaatggctcaatactgatgccttttggatttacaatgatgcatcattatttgggttat
gaaggaagatgcgccatgccatctaattttgattctaactattgttacgcactgggccat
tgcgcaggagcgttggtttataaaggtatgaatggttacttggcagttataagaggatta
gaagggaatcctcttagttggcaagcatgcggtataagtattactagaattatggaagtt
aaaaaatccagacaagacggtcagtgctatgctgcagttactcgtcagttagtcgatttg
aatgggccacttttcaaactattaaaacaggttcgagatatttggaagtttcaagattta
tatagggcgcctggacctttacaattcgaaggcccatgctctgaaactatcccttatatt
gtaagaacgccggagttacaagatttattatgcggagaggatgcctcagttacagatact
gatataaatattgtacaaccaaataatgggggagggaaaagaggtgtatttaatagaatt
cagggaaccctctcctctctccaactttatcgcacaacatatagacctccgttgccactg
ctacttacccaccttaaagcaagatgtaaaccgactactcaatataatttatctgatcct
ctgataaaaagacagattacaacctgttatcctcatttatgtaattcaaatcacttttat
tgccaagaagcgcaacttgacatttcatctgaagagcccaatgtagggttgagaatagga
gtattgcttatgtctagacaagcacctggaattgcaaatgtggtatggggactataccac
cgtctgaaaatggtaaggggaagatgtttgggcttttatggagttaaaggatttttgcaa
gggaagcatattacacttactgagaaagatgtagatcttttgccaaatcaaggaggatcg
gaattaattggaagaacgtatacagagtgtttagtttcgaaagagaatttggaaaaggct
agaaaggtttgtgaaagtttacatttggatggccttgtattgtgtggctctgcatttgga
atgacccagggcgcaatcttggcagagtattttctacaaaataactgtaatactaaggtt
gttggcgtcccagcaactgcgtctaacaacttagcaaatgatctagtagaggcatgcgta
gggtttgattcaagcactaaattgtatgcaagcttaattggaaatgtattaacggatgct
gcttcaatgcctaaatattggcattttattagattaatgggaaggcaaccttcaaatgaa
gttctggagtgcgcactacagacacatccaaatgttgtaataattgctgaagaatatgga
gcagctgataaaactcttgttcacatcgtagaagatgtggcagatgtaatatgtaagaga
gcggagtttggaaagaacttcggaactgtactcattccagatgcattactttcacattta
ccagatatgaagattttaatttctgaaataaatgaattacgaagattcgctgaagaacat
tccgagatgaaattatttatgtctgaaatgatgagtttgggacacagcgatcaccccaca
ttgtccgatcacacaaatagccaagaaaaaagctctcgcgtagatgtggctgataacaaa
agttcggctgcgaatcaggaacatagccctacagatagctttgatggaagtaaatactct
tctaaaatgactccctggagtctcgcattatttaagtcattacctaggttcattagaaga
gaaatactttcattagatgttgactctgcattttccgcgatagagaccgaggcacttctt
gttttaatgataaaaaaggagcttaagaaaagaaaacaagataataaatataatggcaat
tttcagccgtttacacacttttttggatatcagggtagatctgctatgccatcacagttt
gatgcaaagctagggtatgcgcttgggcattttgcttcgatagttgttgagagcggacta
acaggccatctttgttctattagagggttgtgcggcgatgtttccgattggagaatgaca
gcaataccatttaattgcctaatgaaaattgttccttccaacgatgagacccatcctgaa
ctcccaagcaacattcctacaattccttctagtgaagtggatctgaaaggtaaagcatat
cgttggttaaaaatcgttcaggaacattgggcaatgcaagaccgcttttgcaaccctggg
cctatacaatttgatggggctgctgcaaacttttatttcagaacacttcatgagcaacaa
tcagagtactatgagatgcttaagcatgtgcaaaattacgcggagttggttagagaaacg
tgcacatttggcgtaaatgagtcatttctgaaaactgcgtttgtaactctgaacggccta
cttaatctgcgctatcgtgatggaagtctactctcgtcgcttccagatattgggccgatt
atactacaaatgaaatctaattcgggaatgttaaacaatcctacaggtcaaggcgaaaca
atagaaccaatagccagtgagctctcaaacaaggctgcaagcaatctccatacgtcaaaa
tatatttcacaaaacaacctgcacatggcacagtcgatctgtcctggagtagaagagggg
ccatggaacaaaactaaatga

DBGET integrated database retrieval system