KEGG   Cryptosporidium parvum: cgd2_3450Help
Entry
cgd2_3450         CDS       T00168                                 

Definition
ubiquitin C-terminal hydrolase of the cysteine proteinase fold
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
cpv  Cryptosporidium parvum
Brite
Enzymes [BR:cpv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     cgd2_3450
Peptidases [BR:cpv01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   cgd2_3450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
2
AA seq 384 aa AA seqDB search
SNMGNSVPSSSSSVSSETVNTNRNGAENMSSPIGIKNFGNTCYMNAGLQFISAMGIFTEE
NFGGIKLNKSSSEEVCRSLISILIQLGKPSRITDAISPYQLFKQLRQQNSDLFNQHQQDA
HEFIMYILEIIHDGTIKPCNAPKLSNEDLEKLSKKSTRPGNVFWNNHMMRNNSILNNTIC
GQFRSRITCENCGNNSDTFDPFWDITLALPEVSDDYEKISIGSCFRKFFEQQNLFHENDE
PNYNCSHCKSVVNATRCINISQFPNVLLVTLKRFNNNGEKCNGIVSFKTAGIILKSLTEI
GHFKLVAVLQHNGSTLFQGHYISYVFKKEFNGWFKFDDDIVTLVDDILEEDIQAYCLLYI
LESKSALNSNSEQAYSVGIRNQRN
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
agtaatatggggaattcagttccctcatcttcatcgtcagtatcatcagaaacagttaat
acgaataggaacggggctgaaaatatgagtagtccaataggaataaagaattttgggaac
acgtgttatatgaatgctgggttacagtttatatcagcaatgggaatctttacagaagaa
aattttggagggataaaacttaataagagctcctcagaggaggtttgtaggtcattaata
tcaattttaattcagttaggaaaaccaagtagaataacagatgcaatttctccatatcaa
ctttttaagcagcttagacaacagaactctgatctttttaaccagcatcaacaagatgca
catgaatttattatgtatattttggaaataatccatgatgggactattaaaccatgtaat
gctccaaagctgtcaaacgaagatcttgagaaattgagcaaaaaatcaacccgaccagga
aatgttttttggaataaccatatgatgagaaataattcaattttgaataatacaatatgt
ggacagttcagaagtagaataacttgcgagaattgtggaaataatagtgatacttttgat
cccttttgggatataacattggctcttcctgaagtttcagatgattatgagaagatttca
attgggtcttgctttagaaagttttttgagcaacagaatctttttcacgaaaatgatgaa
ccaaattacaattgttcccattgtaagagtgttgtaaacgcaacaagatgtataaatatt
tcgcagttcccaaatgtattgcttgtaactttaaagaggtttaataacaacggagaaaaa
tgtaatgggattgtttcctttaaaacagcaggaataatactcaaatctctcacggagatt
ggccacttcaagttagtagcagtgcttcaacacaatggaagtactcttttccaaggccat
tatatctcctatgttttcaaaaaggagttcaacggatggtttaaatttgatgatgatata
gtcactttagtagacgatattcttgaggaggatattcaggcttactgccttctttatatt
ctcgagtcaaagagcgctttgaactccaactctgaacaagcttattctgtgggtataagg
aatcagagaaattag

DBGET integrated database retrieval system