KEGG   Cryptosporidium parvum: cgd2_360Help
Entry
cgd2_360          CDS       T00168                                 

Definition
prtip-like IF39 eukaryotic translation initiation factor 3
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
cpv  Cryptosporidium parvum
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    cgd2_360
Translation factors [BR:cpv03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    cgd2_360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
2
AA seq 724 aa AA seqDB search
MFKVTREELGEDIDLLEYLSDSTYDGEETEEYISKRCNTIEEPLTLSDSFSKSFVIFGLP
CIGSDKYERFLKALRTIINQTLKMMRVEYDENFLLDVPQDVDGSTKGVAILTFSNSFQAE
TVCQALSKAPFDKQTKFNTVMFDDVKRIIEQDESAPGHFETLYPPPTLFSRDDVRNWLMG
PRCREQFVIRYQSATEIYSFDSIQRIPELIYDGERAKGGKRVWTDFSVQWSPMGSYLVTF
HRQGVALWGGDDWDKKIRFEHKDVKFIDFSPNEEYLLTWDGSSPDSRFDKAVKVWHVLSG
RLLRCFSTPTMTLNNNGTDSGLHFLWSPTGNYLAHCSDKGELFVYESSTMTLVEDPATGN
KNPLKYPLQFFDWSPEEDNLSIWCPERGDTPGRLTLLSIKNRKELAIKNVFNVREASVHW
QPKGQYMCLKALVSRKAGKKAKKEYTQLEIFRVKEKNVPVDTVHIEGVTVKCLSWESSNR
FAIVVVDDVTRSQTLRFYQVNATQTDFVCSYYLTSPVDTIKWSPLGSYFVLGGSGGNLTF
CQLTNENKFDILQKDEHFMCNWIQWDPTGRYVTTAFQSKLAEGAYKYSTETGFIVWSFQG
RQLYNSPLETFYQFIWRPHPPSLLSQEKFDEIPRKLKDYSKKFDAEDEAVRSEKRNIVLQ
KRKVNEDEFNAILQKIQEWKVQQPLYKEWLAAKEVLLNSLQWEEQEEVIEIELETIQEVI
STEV
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagttactcgtgaagaattaggtgaagatattgatcttttggagtatttaagt
gactccacatatgatggggaggaaactgaagaatatatttccaagagatgtaatacaata
gaagaaccactgactttatcagactcattttctaaaagctttgttattttcggacttcca
tgtattggctcagataaatatgagagatttcttaaagctcttagaacaattattaatcaa
acccttaaaatgatgagagtggagtatgacgaaaattttttacttgatgtacctcaggat
gtagatggaagcacaaaaggagttgctatattgacattttcgaattcattccaagcagaa
actgtttgccaagcactttcaaaggcaccatttgataaacagacaaaatttaatacagta
atgtttgatgatgtaaaaagaattattgaacaagatgaatcagctccaggacattttgaa
actctatacccaccaccgactttattcagtcgagatgatgtaagaaattggttaatgggg
ccaaggtgtagagaacaatttgttattagataccaaagcgcaactgagatctattcattt
gattctattcaaagaattcctgaattaatttatgacggtgaaagagctaaaggaggaaaa
agagtttggacagatttttctgtgcaatggagtccaatgggttcttacttagtgacattc
catcgtcagggtgttgcactttggggaggtgatgattgggataagaagattagatttgaa
cacaaagatgttaaattcattgatttcagcccaaatgaagaatatttattaacatgggat
ggttcttctccagattcaaggtttgataaggcagtaaaagtatggcatgtactttctgga
cgacttttaagatgcttttccacaccaactatgacacttaacaataatggaactgatagt
ggtttacatttcctttggagtccaactggaaattatcttgcacattgctccgataaagga
gaactttttgtctatgaatcttccacaatgactcttgtagaagatcctgctacaggtaat
aagaacccattaaagtatccacttcagttctttgattggtcccctgaagaagacaacctt
tcaatttggtgtccagaaagaggagatacaccaggtagacttactttgctttctattaag
aatagaaaagagttggcaataaagaatgtctttaatgttagagaggcatctgtccactgg
caaccaaaaggtcagtatatgtgtcttaaggctctagtttctagaaaagctggtaaaaag
gcaaaaaaagaatatactcagcttgagatctttagagtaaaagagaaaaatgttcctgtt
gatactgtacatattgaaggtgttactgtcaagtgcttatcctgggaatcatctaataga
tttgccattgttgttgtagatgatgttacaagatcccaaacactgagattttaccaagtg
aatgcaacacaaactgactttgtatgctcatattatttaacatctcctgttgacacaatt
aaatggagtccacttggtagctattttgttttaggtggatctggaggaaatttaacattc
tgtcagctcacaaatgaaaacaaatttgatatcttgcaaaaagatgagcattttatgtgt
aactggattcaatgggatcctaccggtagatatgttacaacagctttccaatcaaagtta
gctgaaggtgcatataaatacagcacagaaacaggtttcatagtttggtctttccaaggc
agacaactttacaactcaccattggagacattttaccaatttatttggaggcctcatccc
ccttcacttctttcacaagaaaagtttgatgaaattcctagaaaacttaaagattacagc
aaaaagtttgatgctgaagatgaggctgtcagatctgaaaagagaaatattgttctccaa
aagagaaaagtcaacgaggatgaattcaatgctattctccaaaagattcaagaatggaag
gttcagcaaccactttacaaagaatggcttgcagcaaaagaagtcctacttaattcctta
caatgggaagaacaagaagaagttatcgagattgagcttgaaactatccaggaagttatt
tccactgaggtttag

DBGET integrated database retrieval system