KEGG   Cryptosporidium parvum: cgd2_4080Help
Entry
cgd2_4080         CDS       T00168                                 

Definition
RP-A, OB fold single strand binding protein
Orthology
K10739  
replication factor A2
Organism
cpv  Cryptosporidium parvum
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    cgd2_4080
   03420 Nucleotide excision repair
    cgd2_4080
   03430 Mismatch repair
    cgd2_4080
   03440 Homologous recombination
    cgd2_4080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
2
AA seq 362 aa AA seqDB search
MNFGGNNKPFGGFGMDDLNESGGFMIDGNDSSMQNGNERKQSVGNEQKLAPLKVGMILRS
YSNFVTLSRFQLFDKDINLFKLVGFVRNVEHDDYPQRLRFYLDDGSGLILIDWLVDNTGT
KYKQDLVNSIHEGCFVKIFGELTLMVSEPSVRAFVVRPLVCTDEISLHDIDVASYIVRSM
YGNTYDSGKVQLSDSNVIINKQGSMNYGGAGDSVKDSNQSIVSSMFNLSGQFGSNNNNNT
NNKNEGNFNNYGGNNNFGNEQNISMNKPPIRVVSAIAPKSNQFNSGAGVQSNPLKLREII
SSVLDQASNEGNPEMTIDGIFDSLLTRDVHATHDDIRNQLKNLVGEAKVYQTNPHTWRAT
GY
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaattttggtggaaataataaaccttttggaggatttggaatggacgatttgaatgaa
tctggtgggtttatgattgatgggaatgatagttccatgcaaaatggaaatgaaagaaaa
caaagtgtaggaaacgaacagaaattagcaccattaaaagttggtatgattcttcgatca
tatagcaattttgtaacattaagcagatttcaactttttgacaaagatattaacttgttc
aagttagtaggatttgttagaaatgttgagcatgatgattatccacaaagactacgtttt
tatttagatgatggatcaggattaatcctaatagactggctagtagataatacaggaaca
aagtacaagcaggatttggtaaattctatacacgaaggatgctttgtaaagatatttgga
gaattgactttaatggtttcggaaccatcagtaagagcttttgtagtgcgcccattagta
tgtactgatgagatttcattacacgatattgatgttgcaagctatatagtaagaagtatg
tatggcaatacttatgattcagggaaagtacaactttctgactctaacgtaataattaac
aaacaaggatcaatgaattacggaggtgcaggagattctgtaaaggattcaaatcaaagt
attgtatcttcaatgtttaacttaagcggacaatttggaagtaataacaacaataatacg
aataacaaaaatgaaggtaactttaataattatggaggtaataacaactttggtaatgaa
cagaatatctcgatgaataaaccaccaatcagggtagtttcagctattgcaccaaagtct
aatcaattcaattcaggagctggagttcaaagtaaccctctaaagttaagagaaatcatt
tcctctgtattagaccaagcatcaaatgaaggtaacccagaaatgactattgatggaatc
tttgactctttattaacaagagatgttcatgccacacatgatgatattaggaatcagctt
aagaatttggttggagaagcaaaagtttatcagaccaatcctcatacttggagagctact
ggatattaa

DBGET integrated database retrieval system