KEGG   Cryptosporidium parvum: cgd2_4340Help
Entry
cgd2_4340         CDS       T00168                                 

Definition
mitogen-activated protein kinase 2
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
cpv  Cryptosporidium parvum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
2
AA seq 563 aa AA seqDB search
MMKYPDGDYMATINTVGERSKLVSEVSMNVANPNISGRMGEKQTRVVQIDNSRVTSVGME
PEIKSDLDCNGGYTSANCTNIVGGKNQVDREVTQNKPLERIGPNNTDFRNSKSTSTTASS
HSGSSLSHPHNKWSIPSRYQVRHLIGTGSYGHVCEAYDSKENRLVAIKKIHRVFEDLVDC
KRILREIAILSRLNHDHIVKILDICVPEDTEHFDEIYLVLEIADSDFKKLFRTPVYLSEL
HVKTLLYNLLVGLKYIHSAGIYHRDLKPANCLVNQDCGVKICDFGLARTVKRPTDTINYN
SVASNNINNSVVNRKSIMTGTSIKSDNSQENGGFQQGGRFLKRQLTGHVVTRWYRAPELI
LLQENYTEAIDMWSVGCIFAELLNMLKENVAYYSDRSPLFPGSSCFPLSPDNKQQTEDYR
FKIRGNRDQLNMIFNVLGSPLDEDIEVLEKEDAKRYIRIFSKRTGIDLQTRFPGASSQSI
DLLKKMLVFNPNKRITVDEALSHSLFKNIRNEMLEIISHEKVTLPFDDWSSMTERELRYF
FLKEIQRFSPDLVIPDSIKMDID
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatacccagatggagattatatggcaacgattaatacggttggagaaaggtca
aagctagttagtgaagtttctatgaatgtagcaaatccaaatatttccggaagaatggga
gagaaacaaaccagagttgttcagattgacaattcaagagttacaagtgtagggatggag
cctgagataaaatctgacttagattgcaatggcggctacacgtctgctaactgtacaaat
atagtcggaggaaaaaatcaggtagacagagaagtcacacaaaataaaccattagaaaga
ataggtccaaataatacagattttagaaatagtaaatcaacttctacaacagcatcatct
cattcaggctcttcactttctcaccctcataataaatggagtataccttcaagatatcaa
gtaagacacttaattggtacaggctcttatggccatgtatgcgaggcatatgatagtaaa
gaaaaccgtttagtggcaattaagaagattcatcgagtttttgaggatttggtcgattgt
aaaaggattttgagggaaattgcaatattaagtaggctgaaccatgatcatatagttaaa
attttggatatctgcgttccagaagatactgaacactttgatgaaatttatttggtattg
gagattgccgatagtgatttcaaaaagttgtttagaaccccagtatatctatcagaatta
catgtaaaaacactattatataatctcttagttggacttaaatatatccattcggcagga
atttatcatagagatttaaagccagcaaattgcctagttaatcaagactgtggagtaaaa
atttgtgactttggattagccagaacagttaaaaggcctacagatactataaattataac
tctgttgcaagcaataatattaataattcagtggtgaataggaaatctataatgactggc
actagtattaagagtgataattcgcaagaaaatggaggatttcaacagggagggaggttt
ttgaaacgccaacttactggacatgtagtaacaagatggtaccgtgctcctgaacttatt
ttattgcaagaaaattatactgaagctattgatatgtggagtgttggatgtatttttgct
gaacttcttaacatgcttaaagagaatgtagcatattatagtgatagaagtccgcttttc
ccaggtagcagctgtttcccactttcacctgataataaacaacaaactgaagattatcgt
tttaaaattagaggaaatagagatcaactaaatatgattttcaacgtcttgggttctcca
ttagacgaagatattgaagttctagaaaaagaagatgcaaaaagatatattcgtattttc
agtaagagaacgggaattgacttacaaacaaggttcccaggtgcttcaagccaatcaatt
gatttactcaagaagatgttggtttttaatcctaataagaggattactgttgacgaagct
ttgagtcattcgctctttaaaaatataagaaacgagatgctcgaaattatatctcatgaa
aaagtaacacttccattcgatgattggagctctatgacagagcgagaactaagatatttc
tttttaaaggagatacaaagattttctcctgacttggttattccggattccattaaaatg
gacattgattaa

DBGET integrated database retrieval system