KEGG   Cryptosporidium parvum: cgd2_4340Help
Entry
cgd2_4340         CDS       T00168                                 

Definition
(RefSeq) mitogen-activated protein kinase 2
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cpv  Cryptosporidium parvum
Pathway
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    cgd2_4340
Enzymes [BR:cpv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     cgd2_4340
Protein kinases [BR:cpv01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   cgd2_4340
Chromosome [BR:cpv03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     cgd2_4340
Exosome [BR:cpv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   cgd2_4340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
2
AA seq 563 aa AA seqDB search
MMKYPDGDYMATINTVGERSKLVSEVSMNVANPNISGRMGEKQTRVVQIDNSRVTSVGME
PEIKSDLDCNGGYTSANCTNIVGGKNQVDREVTQNKPLERIGPNNTDFRNSKSTSTTASS
HSGSSLSHPHNKWSIPSRYQVRHLIGTGSYGHVCEAYDSKENRLVAIKKIHRVFEDLVDC
KRILREIAILSRLNHDHIVKILDICVPEDTEHFDEIYLVLEIADSDFKKLFRTPVYLSEL
HVKTLLYNLLVGLKYIHSAGIYHRDLKPANCLVNQDCGVKICDFGLARTVKRPTDTINYN
SVASNNINNSVVNRKSIMTGTSIKSDNSQENGGFQQGGRFLKRQLTGHVVTRWYRAPELI
LLQENYTEAIDMWSVGCIFAELLNMLKENVAYYSDRSPLFPGSSCFPLSPDNKQQTEDYR
FKIRGNRDQLNMIFNVLGSPLDEDIEVLEKEDAKRYIRIFSKRTGIDLQTRFPGASSQSI
DLLKKMLVFNPNKRITVDEALSHSLFKNIRNEMLEIISHEKVTLPFDDWSSMTERELRYF
FLKEIQRFSPDLVIPDSIKMDID
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatacccagatggagattatatggcaacgattaatacggttggagaaaggtca
aagctagttagtgaagtttctatgaatgtagcaaatccaaatatttccggaagaatggga
gagaaacaaaccagagttgttcagattgacaattcaagagttacaagtgtagggatggag
cctgagataaaatctgacttagattgcaatggcggctacacgtctgctaactgtacaaat
atagtcggaggaaaaaatcaggtagacagagaagtcacacaaaataaaccattagaaaga
ataggtccaaataatacagattttagaaatagtaaatcaacttctacaacagcatcatct
cattcaggctcttcactttctcaccctcataataaatggagtataccttcaagatatcaa
gtaagacacttaattggtacaggctcttatggccatgtatgcgaggcatatgatagtaaa
gaaaaccgtttagtggcaattaagaagattcatcgagtttttgaggatttggtcgattgt
aaaaggattttgagggaaattgcaatattaagtaggctgaaccatgatcatatagttaaa
attttggatatctgcgttccagaagatactgaacactttgatgaaatttatttggtattg
gagattgccgatagtgatttcaaaaagttgtttagaaccccagtatatctatcagaatta
catgtaaaaacactattatataatctcttagttggacttaaatatatccattcggcagga
atttatcatagagatttaaagccagcaaattgcctagttaatcaagactgtggagtaaaa
atttgtgactttggattagccagaacagttaaaaggcctacagatactataaattataac
tctgttgcaagcaataatattaataattcagtggtgaataggaaatctataatgactggc
actagtattaagagtgataattcgcaagaaaatggaggatttcaacagggagggaggttt
ttgaaacgccaacttactggacatgtagtaacaagatggtaccgtgctcctgaacttatt
ttattgcaagaaaattatactgaagctattgatatgtggagtgttggatgtatttttgct
gaacttcttaacatgcttaaagagaatgtagcatattatagtgatagaagtccgcttttc
ccaggtagcagctgtttcccactttcacctgataataaacaacaaactgaagattatcgt
tttaaaattagaggaaatagagatcaactaaatatgattttcaacgtcttgggttctcca
ttagacgaagatattgaagttctagaaaaagaagatgcaaaaagatatattcgtattttc
agtaagagaacgggaattgacttacaaacaaggttcccaggtgcttcaagccaatcaatt
gatttactcaagaagatgttggtttttaatcctaataagaggattactgttgacgaagct
ttgagtcattcgctctttaaaaatataagaaacgagatgctcgaaattatatctcatgaa
aaagtaacacttccattcgatgattggagctctatgacagagcgagaactaagatatttc
tttttaaaggagatacaaagattttctcctgacttggttattccggattccattaaaatg
gacattgattaa

DBGET integrated database retrieval system