KEGG   Cryptosporidium parvum: cgd3_2030Help
Entry
cgd3_2030         CDS       T00168                                 

Definition
choline kinase
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
cpv  Cryptosporidium parvum
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    cgd3_2030
Enzymes [BR:cpv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     cgd3_2030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
3
AA seq 405 aa AA seqDB search
KKKKEMPFPNKKIELGDKLSESIRSFSTITDTEIIIGICRKNIPGWKEINESYIEVKQIF
SGLTNQLFVVSIVNESMSLSLKHPRILFRIYGKHVGKFYDSKVELDVFRYLSNINIAPNI
IADFPEGRIEEFIDGEPLTTKQLQLTHICVEVAKNMGSLHIINSKRADFPSRFDKEPILF
KRIYLWREEAKIQVSKNNFQIDKELYSKILEEIDQLEELIMGGEKFSMERALELKLYSPA
FSLVFAHNDLQENNLLQTQNNIRMIDYEYSAINFAGADIANYFCEYIYDYCSEKQPYFKF
KYEDYPCEELRKLFISVYLSQTLQEQVMPSQQIVHIMTKAVEVFTLISHITWGLWSIART
PGYQPNSVEFDFTEYANTRFTHYLQKKKELIDQGILPLNSWLFNL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
aaaaaaaaaaaagaaatgccattcccgaacaagaaaatcgaactaggtgacaaattatca
gaatcaattaggtctttctcgactattacagatactgagataataataggtatatgtcga
aaaaatattccgggttggaaagaaattaatgagtcgtatattgaagttaaacagatcttt
tcaggactcacgaaccagctttttgttgtaagtattgtaaatgaatccatgagtttatct
ctaaaacatccgagaattctatttagaatttatggtaaacatgtgggaaaattttatgat
tccaaagtggagcttgatgtattcagatatctgagcaacattaatatcgctccaaacata
attgcagattttccagaaggtagaatagaagagttcattgatggtgagcctttgacaact
aaacaattacagttaacccacatttgtgtagaagtggcaaagaatatgggatctttacac
attattaattcaaaaagagcagatttcccttcaaggtttgacaaggagccaattctcttc
aaaagaatatatctttggagagaagaagctaagatccaagtgtccaaaaacaatttccag
attgataaagaactgtactcaaagatattggaagagattgatcaattagaagaattgatc
atgggcggagaaaagttcagtatggaaagggctttagaattaaaactttattctccagca
ttttctttggtatttgctcataacgatcttcaagaaaacaatctattacagacgcaaaac
aatattagaatgattgattatgagtattcagctataaactttgcaggggcagacatcgca
aactacttttgcgagtatatatatgattactgtagtgaaaaacaaccatatttcaaattt
aaatatgaagattatccatgtgaagagctacgaaagctatttatttcagtgtatttgtct
caaacattacaagaacaagttatgccaagtcaacaaatcgtgcacattatgactaaggct
gttgaagtattcactctaatttcccatattacatggggactgtggtctattgcaagaact
ccagggtaccagccaaactctgtggaatttgactttacagaatatgcaaatactcgattt
acgcattatttgcaaaaaaaaaaagaactaattgatcagggaatattaccgcttaacagc
tggctatttaatttataa

DBGET integrated database retrieval system