KEGG   Cryptosporidium parvum: cgd3_3030Help
Entry
cgd3_3030         CDS       T00168                                 

Definition
MAPK
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cpv  Cryptosporidium parvum
Brite
Enzymes [BR:cpv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     cgd3_3030
Protein kinases [BR:cpv01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   cgd3_3030
Exosome [BR:cpv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   cgd3_3030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
3
AA seq 566 aa AA seqDB search
MKITKNITVNVEDGSTYTVPEHYKFIKKVGSGAYGCVVSFYDKSRGSYIAVKKIFDAFQD
LIDAKRILREIKLLRQLQHENILGIIDLLPPDSPNFEDIYIVTQLMETDLHRVIYSKQTL
TNEHIQYFMYQILRGLSYLHKVNIIHRDLKPSNILVNLSCDLKICDFGLARGNVCDIDKS
KDELTDYVVTRWYRAPEIILCVNRYDKAVDIWSAGCIFAELIKRSALFAGHDHLDQLKAI
ISCLGTPSRDDLDSWLPYKGSTENARKYLDTLPNYKGRHISTLFPGFNCPEAIDLIEKML
SFNPKKRITAEEALSHPYFNGININSGYDSPKSSSAHNIQFKSNNSIEPELISLDSNTTD
SIDWSFDNFEPTKRLLQNKVYEEIADFHPEILIRDFPFIHHLGINVPKKHLQMLRSKYAT
NTLRGKDRINAYMVDSLMSTSSSTSITPSNSFDILGTIDMVKRLSIVHKQNRMSNSQPAQ
SGTIIPSNDYDVGSEGLLLHRSQELCLTTPALQKRTYPFISYPSDSESGNDANLNMENTV
IGVGQRVKSTTDNLKRIAYGKTESNI
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcacaaaaaatattactgtaaatgtagaagatggaagcacgtacacagttccc
gagcattacaagtttattaaaaaagttggaagtggtgcctatggatgtgtagtttcattt
tacgataaatctcgaggatcttatattgcagtaaagaagatatttgatgcatttcaggac
ttaatagatgcaaagagaattctaagagaaattaagcttttaaggcagcttcaacacgaa
aacattttgggtattattgatcttcttcctccagactctccgaattttgaagatatatat
attgttactcagttaatggagacagatttgcaccgtgtgatatatagtaaacagacactg
acaaatgagcatatacaatattttatgtatcaaattttgagaggattatcttacctacat
aaggtaaatattatacaccgtgatctgaagccatcaaatatccttgtaaacttatcatgt
gatttaaagatttgtgattttggcttagcaagaggaaatgtctgtgatattgataaaagc
aaggacgaattaacagattatgtagttacgagatggtacagggcacccgaaataattttg
tgtgtaaatagatacgataaagctgtggatatatggagtgcaggctgtatttttgctgaa
ttaattaaaaggagtgctttgtttgctggtcatgaccatctagatcaacttaaagctatt
atttcttgtttgggtaccccaagcagagatgacttagattcctggcttccttacaagggg
agtaccgagaatgcgagaaagtacttagacacgcttccaaactataagggtaggcatatt
tcaactttattccctggatttaattgccctgaagctattgaccttattgaaaaaatgcta
agctttaatccaaaaaagcgaataacagctgaagaggctctatcgcatccatatttcaat
ggaattaatattaactcagggtacgactctccaaaatcatctagtgctcataacattcag
tttaaatcaaataactctattgaaccagaattaatctcattggattccaacactactgat
tctattgattggtctttcgacaactttgagccaacaaagagactgttacagaataaggta
tacgaagaaattgcagattttcatccagagattttaattcgagactttccgtttattcac
catttaggcatcaacgtcccaaaaaagcatctacaaatgctaaggtcaaagtatgctaca
aatacactgaggggaaaagatagaataaatgcatacatggttgattctcttatgagcacg
tcatcttctacttcaattaccccttccaacagttttgatattttaggtacaatcgatatg
gttaaaaggctgtcaatagtccataaacaaaatagaatgtcaaactctcaacctgcacaa
tcagggactattattccctcaaatgattacgacgttggatctgaagggcttctccttcat
cgttcgcaagaattatgtcttacaacgccagcattacaaaaaagaacatatccatttata
tcataccccagtgactcagaatcaggtaatgacgcaaacttgaatatggaaaacacggtg
atcggcgtgggtcaacgtgtcaagagtactactgacaatttaaaaagaattgcctatgga
aaaacagaaagcaatatataa

DBGET integrated database retrieval system