KEGG   Cryptosporidium parvum: cgd3_3030Help
Entry
cgd3_3030         CDS       T00168                                 

Definition
MAPK
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cpv  Cryptosporidium parvum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
3
AA seq 566 aa AA seqDB search
MKITKNITVNVEDGSTYTVPEHYKFIKKVGSGAYGCVVSFYDKSRGSYIAVKKIFDAFQD
LIDAKRILREIKLLRQLQHENILGIIDLLPPDSPNFEDIYIVTQLMETDLHRVIYSKQTL
TNEHIQYFMYQILRGLSYLHKVNIIHRDLKPSNILVNLSCDLKICDFGLARGNVCDIDKS
KDELTDYVVTRWYRAPEIILCVNRYDKAVDIWSAGCIFAELIKRSALFAGHDHLDQLKAI
ISCLGTPSRDDLDSWLPYKGSTENARKYLDTLPNYKGRHISTLFPGFNCPEAIDLIEKML
SFNPKKRITAEEALSHPYFNGININSGYDSPKSSSAHNIQFKSNNSIEPELISLDSNTTD
SIDWSFDNFEPTKRLLQNKVYEEIADFHPEILIRDFPFIHHLGINVPKKHLQMLRSKYAT
NTLRGKDRINAYMVDSLMSTSSSTSITPSNSFDILGTIDMVKRLSIVHKQNRMSNSQPAQ
SGTIIPSNDYDVGSEGLLLHRSQELCLTTPALQKRTYPFISYPSDSESGNDANLNMENTV
IGVGQRVKSTTDNLKRIAYGKTESNI
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcacaaaaaatattactgtaaatgtagaagatggaagcacgtacacagttccc
gagcattacaagtttattaaaaaagttggaagtggtgcctatggatgtgtagtttcattt
tacgataaatctcgaggatcttatattgcagtaaagaagatatttgatgcatttcaggac
ttaatagatgcaaagagaattctaagagaaattaagcttttaaggcagcttcaacacgaa
aacattttgggtattattgatcttcttcctccagactctccgaattttgaagatatatat
attgttactcagttaatggagacagatttgcaccgtgtgatatatagtaaacagacactg
acaaatgagcatatacaatattttatgtatcaaattttgagaggattatcttacctacat
aaggtaaatattatacaccgtgatctgaagccatcaaatatccttgtaaacttatcatgt
gatttaaagatttgtgattttggcttagcaagaggaaatgtctgtgatattgataaaagc
aaggacgaattaacagattatgtagttacgagatggtacagggcacccgaaataattttg
tgtgtaaatagatacgataaagctgtggatatatggagtgcaggctgtatttttgctgaa
ttaattaaaaggagtgctttgtttgctggtcatgaccatctagatcaacttaaagctatt
atttcttgtttgggtaccccaagcagagatgacttagattcctggcttccttacaagggg
agtaccgagaatgcgagaaagtacttagacacgcttccaaactataagggtaggcatatt
tcaactttattccctggatttaattgccctgaagctattgaccttattgaaaaaatgcta
agctttaatccaaaaaagcgaataacagctgaagaggctctatcgcatccatatttcaat
ggaattaatattaactcagggtacgactctccaaaatcatctagtgctcataacattcag
tttaaatcaaataactctattgaaccagaattaatctcattggattccaacactactgat
tctattgattggtctttcgacaactttgagccaacaaagagactgttacagaataaggta
tacgaagaaattgcagattttcatccagagattttaattcgagactttccgtttattcac
catttaggcatcaacgtcccaaaaaagcatctacaaatgctaaggtcaaagtatgctaca
aatacactgaggggaaaagatagaataaatgcatacatggttgattctcttatgagcacg
tcatcttctacttcaattaccccttccaacagttttgatattttaggtacaatcgatatg
gttaaaaggctgtcaatagtccataaacaaaatagaatgtcaaactctcaacctgcacaa
tcagggactattattccctcaaatgattacgacgttggatctgaagggcttctccttcat
cgttcgcaagaattatgtcttacaacgccagcattacaaaaaagaacatatccatttata
tcataccccagtgactcagaatcaggtaatgacgcaaacttgaatatggaaaacacggtg
atcggcgtgggtcaacgtgtcaagagtactactgacaatttaaaaagaattgcctatgga
aaaacagaaagcaatatataa

DBGET integrated database retrieval system