KEGG   Cryptosporidium parvum: cgd3_3040Help
Entry
cgd3_3040         CDS       T00168                                 

Definition
protein kinase, cAMP-dependent, catalytic chain
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cpv  Cryptosporidium parvum
Brite
Enzymes [BR:cpv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     cgd3_3040
Protein kinases [BR:cpv01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   cgd3_3040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
3
AA seq 392 aa AA seqDB search
MDGIWKRLVSGGKNHSSKEGGNSQKNAVAANNRTCENGRSLDFNTNNKSHNNPNNDTRYP
ATSNMNKHDTDISGNNQKKYSIDDFQLIRTLGTGSFGRVFLSKHKEDNSIYAIKRLKKSV
VIRQKQVDHITNEKAILSRIKHPFLVRMFGTFKDDRYLYIMMEFVIGGEFFTYLRRCRHF
DNETSRFYAAQVVLMFEYLHGKNIIYRDLKPENILIDKDGYLKLTDFGFAKAIEYRTFTL
CGTPEYIAPEVLLNKGHGKPVDWWTLGILIYEMVVGFPPFYDDEPMGIYQKILAGKIFFP
KYFDKNCKSLVKRLLTPDLTKRYGNLKGGVSDIKLHKWFYNYDFNSLISRKVDPPYIPKV
NSYDDSSNFEEYPDSHEQPTTVTGNADPFVDW
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggatggaatttggaaaagacttgtttctggagggaagaatcactcttcaaaagagggc
ggcaatagtcagaaaaatgcagttgctgctaacaatcggacatgtgaaaatggccgaagt
ttagattttaataccaataataagtcccacaataatccaaataatgacacccgttatcct
gctacttcaaacatgaacaagcatgacacggatatatcagggaataaccagaaaaaatat
agcatcgacgattttcagcttattagaacattaggaacaggctcgttcggaagagttttc
ttatctaagcacaaggaagataatagcatttatgcaataaaaagacttaaaaagagtgtg
gttattcggcaaaagcaggtggaccatattacaaatgaaaaagcgattctttcaagaatt
aaacatccatttttagttagaatgtttggaacatttaaagatgaccgatatttatacatt
atgatggaatttgttatagggggagagtttttcacatacctaagaaggtgtaggcacttt
gacaatgaaacttcgaggttttatgctgcgcaagtcgtgttaatgtttgaatatttgcac
ggaaaaaacattatatatagagatcttaaaccagaaaatattctaattgacaaagatggg
tatttgaagctaactgattttggatttgcaaaggcaatcgaatataggacgtttacactt
tgtgggacgcctgaatatatcgctccagaagttcttttaaacaagggccatggaaagccg
gttgattggtggacgctgggcatattgatatatgaaatggttgtaggctttccccctttt
tatgatgatgaacctatgggtatctatcaaaaaattctagcgggtaagatttttttccct
aagtattttgacaaaaattgtaaaagtttggtaaaaagactacttactccggatttaaca
aaaagatatggtaacctcaaaggtggtgttagtgatataaaactacacaagtggttttat
aattatgactttaattctttgatatcaaggaaagttgaccccccgtatattcctaaggtc
aactcgtatgatgattcatcgaattttgaagaatatccagatagccatgaacaacctact
actgttacaggtaatgctgatccattcgttgactggtag

DBGET integrated database retrieval system