KEGG   Cryptosporidium parvum: cgd3_3190Help
Entry
cgd3_3190         CDS       T00168                                 

Definition
GCN5 like acetylase + bromodomain
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cpv  Cryptosporidium parvum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
3
AA seq 655 aa AA seqDB search
MFIEEANASIDRGIRTIIFEEFSPLVVENINKDYLEGIYRDYSDPKLLKLCNNFGFVEFL
KLSNEQGDLNNELIRIFKVTLEEIFSAVLSIINIQQWLSIEARERGPFPTIKKDERASVK
SFVMNYLPDENYENNYNSWKLFLKRDSPAGRKVCEMFKLSFLKSLLLTNIGVILNDIETS
GIFTKFALKSNLSKAICMKFAIKLCVACGIASKESIDHLKRQAWDHLRYISDDETLQSSL
LSETGLGFLHRDSGSAKEEALGIISFECITNDREPEHLVKLIALKNVFARQLPKMPREYI
VRLIFDRNHYSFCLLKKGKVIGGVCFRPYFEQRFAEIAFLAVTSTEQVKGYGTRLMNHLK
QHVKKSKIEYFLTYADNFATGYFRKQGFRKEVSMPKERWFGYIKDYDGGTLMECYINPEI
NYLRLSDLFHEQKSALLRAINTIRPLKVYPGINLWENGDESMVKKDLNIELTSDQKNIES
TISEPMNDGDPAKNFQNDPCAEDFTPIIDTKPENDLNINTKKIKPSDIPGVLEVGWVEKI
IDPVEQSKVDLSMNDQIWQLLDTLSRHENAWPFRKPVSIGEASDYYEIIKEPTDIQTMKR
KAKNKEYKTLSEFSSELKRMFDNCRFYNAKNTIYTKYANQLEAFIWPMLQTIQES
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgtttattgaagaggcaaatgccagcattgatagggggatccgcacaattatcttcgaa
gaattttcgcccttagtcgtagaaaatattaacaaggactacttggaaggaatatataga
gattactccgatccaaaattattaaaattatgtaacaactttggttttgttgaattcctg
aagttatccaacgaacaaggagatttaaataatgaattaatccgaatttttaaggtaact
ttagaggagatattttcagcagtactttctattattaatattcagcaatggctcagtatt
gaagctcgcgaacggggtccatttccaactattaaaaaagatgaaagagcaagtgtaaag
agctttgttatgaactatttgcctgatgaaaattatgaaaataactacaattcttggaag
ctgtttctcaagagagattcccctgcaggtagaaaagtctgtgaaatgtttaaactttca
tttttaaagtccttattgcttacaaatattggagtaattcttaatgatattgaaacttcg
ggaatatttactaaatttgcgttaaaaagcaacttaagtaaggctatttgcatgaagttt
gctattaaattgtgcgtagcatgtggcatcgcttccaaagaatctattgatcatttgaaa
aggcaagcatgggaccatcttaggtatatttctgatgatgaaactctacagtccagtcta
ttgtctgaaactggattgggctttcttcatagagatagtggtagtgcaaaggaagaagct
ctgggtattatttcatttgaatgtattaccaatgatagagagccagaacatcttgttaaa
cttattgcattaaaaaatgttttcgcaaggcaattaccgaaaatgccaagagaatatata
gttagactgatttttgacagaaaccattattctttctgtttgctgaagaaaggaaaagta
atcggtggagtatgttttcgcccgtacttcgagcaaagatttgctgaaattgcgttttta
gctgtaactagtactgagcaggttaaaggttatggtacaagattaatgaaccatttaaag
cagcatgtcaagaaaagcaaaatagaatactttttaacatatgcagataactttgccacg
ggttatttcagaaaacaaggtttcagaaaagaggttagtatgccaaaagaaagatggttt
ggatatattaaagattatgacggtggtactttaatggagtgttatattaatccagagatt
aattatttgagattatccgatcttttccatgagcaaaaatctgcattgttaagggctatt
aatactattagacctttaaaggtctatccaggtatcaatttatgggaaaatggagacgaa
agtatggtcaagaaagatttaaatattgagttaactagtgatcaaaaaaatattgaatca
actatatctgaaccaatgaatgatggtgatccagctaaaaatttccaaaatgacccttgt
gctgaagattttactccaattatagataccaaaccagagaatgatttaaacataaacaca
aaaaaaataaagcccagtgatatacctggtgttttagaggttggttgggtagaaaagata
attgatcctgtcgagcaatctaaggttgacctctctatgaacgatcaaatttggcagtta
cttgataccctatcaaggcatgaaaatgcatggccgtttagaaaaccagttagcataggg
gaagcatcagactactatgagattattaaagaacctactgatatccaaactatgaagcgt
aaagctaaaaataaagaatataagacattatctgagtttagcagcgagcttaaaagaatg
tttgataactgcagattttacaatgcaaaaaatacaatttatacgaagtatgcaaaccag
ttggaggcatttatttggccaatgctacaaacgatacaggaatcataa

DBGET integrated database retrieval system