KEGG   Cryptosporidium parvum: cgd4_2560Help
Entry
cgd4_2560         CDS       T00168                                 

Definition
phospholipase C, delta 1 ortholog with 2 EF hands plus phospholipase C domain plus C2 domain
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
cpv  Cryptosporidium parvum
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    cgd4_2560
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    cgd4_2560
Enzymes [BR:cpv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     cgd4_2560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
4
AA seq 883 aa AA seqDB search
MFRPLLDCNGEISINRLLGSQDLSEYVISVRTFEDVVNKLNIVVSDRLMQLLHEVDVDIA
LDTCKSGSYLYKYPRSCIGSRRFSRYNFEIDLDSGCVKWYKKKKTLICSRKVVFIQTLYL
NDVNHILPGSDSDFWRSKKCTKKEYINSNFGIELVVIGKRNKTLRLLCANKEEWKFWMVG
LLVSHALAQREKLVSKIKGTKKIVDAKHFYTHDYIRRQWELSDLDNSGSISFTELMRLTK
RLQMPVSKDYTHALFCEYDNDNNGALDYKEFRNLLTQLLILPELRDLFDEYKDPDTNVMG
ANKFRNFLIDVQGMDPSNSLESLVNAVLNMKEPFIERGGITEIGFNILMSSEFNSAFDPL
KRDVYQSMDEPISHYWIASSHNTYLTGDQLTSKSEIGQYITVLLQGCRCVELDVWNGPDG
SPIIYHGHTLTSKVYFEDVIRACKDYAFQISPYPIILSLEMHASDKQREKVAEIILNVLG
DSLYIPPNDGSDRLPTPNELKYKFLVKAKVPKEDISFDLRAGVINEDDEKNDLNPDILEV
DLEVSNNTRIENEKQASSYNQNQTKRRLYSSLISLPGNAIQLSNFENRRRMSIGSLVETK
FLRLAKDSSMSLAKFHQDHLCRVYPSGTRISSSNYNPLIPWSYGAQIVALNYQAVGTALL
LNEGRFRQNGGSKSGYVLKPKMCLKKCFDGRVFDPMNPLETLELFDIPPVRVCIQILSAH
QLPDNLSQFSRGIAGLISGNKLSPYITISVFGGPSEEFKSYRTPVINNNGFNPKWENLSP
FTFNVLCPEISIINFEVKSSDSIQSEFIAAASIPVSCLRPGLRWIQLFDANFIDIQCCGI
LANISITTELPKTYMLSSILTGNNGSSSTNLQETLQQFRGIKF
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgtttcggccgttgttagactgtaatggagaaattagcattaatagattgctcggaagt
caagatctatccgaatatgtaatatccgttcgcacatttgaggatgtagtaaacaaattg
aatatagttgtaagtgacagactcatgcaattgcttcatgaagttgatgtagatattgca
ctagatacatgcaaaagtggctcttacctatataaatatccgcgttcttgtattggtagt
agacgcttttcaagatataactttgaaattgacttagattctggatgcgtaaagtggtat
aaaaaaaaaaaaactttgatttgttctagaaaagtggtatttattcagactttatatcta
aatgatgtaaaccacattcttccaggatctgatagtgacttttggaggtcaaagaaatgt
acaaagaaggagtatatcaattctaattttgggattgaactagtagtaataggaaaaaga
aataaaacactaagacttttatgcgcaaataaagaagaatggaaattttggatggtcggg
ctgttggtaagccatgctcttgctcaaagagagaagttagtctcaaaaattaaaggaaca
aaaaaaattgttgatgctaaacatttttacactcacgactacattaggcgtcaatgggaa
ctttcagatttagataactctggttcaataagcttcacagagttaatgcgtttaacaaag
agattgcagatgccggtatctaaagattatactcacgctctcttttgtgaatatgataat
gataataatggtgcacttgattataaggaatttagaaatttgttaactcagcttttaata
ctccctgagttgcgtgatttatttgatgaatataaggatccagatacaaatgttatgggt
gcgaataaatttcgtaattttctgatagatgttcaaggaatggatccgtcaaactcatta
gaatcactagttaatgctgtattaaatatgaaagaaccgttcattgaaaggggtggtatt
actgaaattgggttcaatattctaatgtcttcagaatttaactccgcatttgatccatta
aaaagagatgtatatcaatcaatggatgaacctatttcacactactggatagcttcgagc
cacaatacttatttaactggcgaccaactaacttcaaaatccgagattggacaatatata
actgtattacttcaaggatgtagatgtgtagagttggatgtttggaatggcccagatgga
tcaccaattatttaccatggccacactttaacatctaaagtttactttgaagatgtaatt
cgagcatgcaaagactatgctttccagatatctccatatccgattattttatcgcttgaa
atgcatgcatctgataaacaacgtgaaaaggttgcagaaataatattgaacgtattaggc
gattctctttatattcccccaaatgatgggagtgatagacttcccaccccaaatgaactt
aaatataaatttcttgtcaaagctaaggtcccaaaagaagatattagttttgatttaaga
gcaggggttattaatgaagatgatgaaaaaaatgatctaaacccagacatattagaagtt
gatctcgaagtgtccaacaatacaaggattgaaaatgaaaagcaagcctcgtcttacaat
caaaatcagactaagaggagattatattctagtctaatttcccttccaggaaatgcgata
caactgtctaattttgaaaatcgaagaagaatgagcattggttctcttgttgaaacaaaa
tttctgcgccttgcgaaagactcaagtatgagtcttgcaaagttccatcaagatcatcta
tgtagagtttatccatcaggtacacgtatatcgagttcaaactataatcctttaatacca
tggtcatacggagctcagattgtcgcattgaattaccaagcagttggaactgccttatta
ttgaatgaagggagattcagacaaaatggtggctcaaaaagtggctacgtactaaaacca
aaaatgtgcctaaaaaagtgctttgatggacgggtattcgatcctatgaaccctttagaa
actttagagctctttgatatccctcctgttagagtgtgtatccaaatactatcagctcac
cagctccctgacaatctatcgcagttctcacgtggaattgcaggcctaatatctgggaat
aaactttcaccatacattactatttctgtttttggagggcccagcgaagagttcaagtca
tacagaacgcctgtaataaataataatgggtttaatccaaaatgggaaaacttgtctcca
tttacattcaatgttctttgcccagaaatttcgattattaatttcgaggttaagtcatca
gattcgatacagtctgaatttattgcagcagcttcaattcctgtttcatgccttagacct
ggtttaaggtggatacaactatttgatgcaaattttattgatatccagtgttgtgggatc
cttgcgaacatttctataacaacagaattaccaaaaacgtatatgttatcatcaatttta
acaggaaacaatggaagctcatcaacaaatctacaagaaacattgcaacagtttagagga
attaaattttga

DBGET integrated database retrieval system