KEGG   Cryptosporidium parvum: cgd4_2700Help
Entry
cgd4_2700         CDS       T00168                                 

Definition
probable NADPH-cytochrome p450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
cpv  Cryptosporidium parvum
Brite
Enzymes [BR:cpv01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     cgd4_2700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
4
AA seq 651 aa AA seqDB search
MPFFYINNALNYLSICNISIGFILVLKKLAQLSSEYIENNVPSNFSIFYSTETGNSRKIS
ELFKKLLDEISIEANVREINSILEENMYLNSNNSVFVFVVSTCGNGSFPASSRKFIRYLS
KMIKSGNEIFLGIKYTIIGLGSSLYEYSFNSAALKLDKLISSLKGEKYCEIALLDEVNGN
EIDFKTWWNNTFLNRLGISDSKEHLNKHFSIAVTRKKDEFVCKLRSINEISLYNHSLSGN
CHVSEIYFKLIEFCPINRELLCETKTIDGIERQIFNLKLELPDKVQYKTFDIIDILPPNL
DENITFFSSKVLGINSIEDLKNITVEFVPINNMTRNISVPFPNNRSLMHILKYYFDLMTL
PPHSVMLQFVPYLNSIEGELISNESFFNENKDSYEFSFHLFINRFMKSLIPIPIEKFVKF
TGIRQYPRSYSISSSSLASPSMIDLTISTCIKGQISAPLNEIISEGANKKNSKKIIKGLC
SSFLFEFDLNLPVLGMIRSSSLNIDNVTSSALMFSHGSGIAPIRALLHERKYLINEKKII
KPAYLFYGCRTENEIIYKDELKDFKRIGALTEVFFALSKTQKKYVKDIIPFYKHIILKVV
DQNDSIIYICGKKEFVSGIKNEVASIISNNRSRNIIKKMFVEGRIFIESWN
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgccttttttttatattaataatgcattgaactatctctcaatatgtaacatttctatt
ggattcattcttgttctgaaaaaactagcccaattaagttctgaatatatagaaaataat
gtcccatctaatttctcaatattttactcaacggaaacgggaaattcaagaaaaatatca
gaattgttcaagaaactactagatgaaataagcattgaagccaatgtccgtgagataaac
tcgatactagaagaaaacatgtatttaaatagtaacaattcggtgtttgttttcgtagtt
tctacatgcggaaatgggagctttccagcatcgtcgaggaaattcattcgttatctttcg
aaaatgataaaatctgggaatgaaatatttttaggaatcaaatacactattattggcctt
ggaagctccttatatgaatactcttttaattctgcggctttaaagcttgataaattgatc
tcttcacttaaaggtgagaaatattgcgaaattgcactcttggacgaagtgaatggtaat
gagattgattttaaaacatggtggaacaatacatttttaaataggcttggaatttcagat
tcaaaagaacatttgaacaaacatttcagtatagctgtaacgagaaaaaaagatgaattt
gtttgtaaattgagaagtattaatgaaatctcactttataatcactctctctctgggaat
tgccacgtttctgaaatttacttcaagctaatagaattttgccccattaacagagaatta
ttatgtgaaacaaaaactatcgatggcattgaaagacaaatttttaacttaaaacttgaa
cttcctgataaagtacaatataagacatttgatattatcgatatacttccaccaaacctc
gatgaaaacattacttttttttcaagcaaagtattgggaataaacagtatcgaagattta
aaaaatattactgttgaatttgtgccaataaataacatgacgagaaatatcagtgtccca
tttcctaataatcgctctttaatgcatatactaaagtactattttgatcttatgacttta
cctcctcactcagtaatgctacaatttgttccttatttaaattcaatagaaggagagctt
atttccaacgaaagtttttttaatgaaaataaggattcttatgagttttcttttcattta
tttataaatcgttttatgaaaagtcttattccaataccaatagaaaagtttgttaaattt
actggaatcagacaatatccaaggagctattcaatttcatcctcctcactcgcttcacca
tcaatgattgatttaacaattagtacgtgtattaagggccaaatctctgccccattaaat
gaaataattagcgaaggggcgaataaaaagaattccaaaaaaattatcaaaggattgtgt
tcaagttttctttttgaatttgatttgaatttgcctgtactaggaatgataaggtcatct
tctctcaatatagacaatgtgacatcatctgcactaatgttttcacatgggagtggtatt
gcgcctattagagcactattacatgaacgaaaatatttaattaatgaaaaaaaaattata
aagccagcgtatttgttttacggatgcagaacagaaaatgaaataatttataaagacgaa
cttaaggactttaaaagaataggtgcattaactgaagttttttttgctttgtctaagaca
caaaaaaaatacgttaaagacataattcctttttataaacacatcattttaaaggtagtt
gatcaaaatgattcaataatatatatctgtgggaaaaaggaatttgtttcagggatcaaa
aatgaagttgcatcgatcatttctaataatcgttcgagaaatattattaaaaaaatgttt
gttgaaggtagaatttttatagaatcatggaattga

DBGET integrated database retrieval system