KEGG   Cryptosporidium parvum: cgd4_4460Help
Entry
cgd4_4460         CDS       T00168                                 

Definition
dihydrofolate reductase-thymidylate synthase
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
cpv  Cryptosporidium parvum
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    cgd4_4460
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    cgd4_4460
   00670 One carbon pool by folate
    cgd4_4460
Enzymes [BR:cpv01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     cgd4_4460
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     cgd4_4460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
4
AA seq 531 aa AA seqDB search
IIVVNFRTFKMSKKNVSIVVAASVLSRGIGINGQLPWSISEDLKFFSKITSNNCDSNKKN
ALIMGRKTWDSIGRRPLKNRKIVVISSSLPQDEADPNVIVFRNLEDSIKNLMNDDTIENI
FVCGGESIYRDALKDNFVDRIYLTRVALEDIEFDTYFPEIPETFLPVYMSQTFCTKNISY
DFMVFEKQEKKTLQNCDPVRGQLKSIDDTVDLLGEIFGIRKMGNRHKFPKEEIYNTPSIR
FGREHYEFQYLDLLSRVLENGAYRENRTGISTYSIFGQMMRFDMRESFPLLTTKKVAIRS
IFEELIWFIKGDTNGNHLIEKKVYIWSGNGSKEYLERIGLGHREENDLGPIYGFQWRHYN
GEYKTMHDDYTGVGVDQLAKLIETLKNNPKDRRHILTAWNPSALSQMALPPCHVLSQYYV
TNDNCLSCNLYQRSCDLGLGSPFNIASYAILTMMLAQVCGYEPGELAIFIGDAHIYENHL
TQLKEQLSRTPRPFPQLKFKRKVENIEDFKWEDIELIGYYPYPTIKMEMAV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
attattgttgtgaatttcagaacttttaaaatgagtaaaaagaacgtttcaattgttgtg
gcagcttctgttttgagtagaggaataggaattaacggacaattaccttggtctatatct
gaggatttgaaatttttttcaaagataactagtaataattgtgactcgaataagaagaat
gcactaattatgggaagaaaaacatgggattcaattggaagaagacctcttaaaaataga
aaaattgtcgttatttcctctagcttaccacaagatgaagccgatcctaatgttattgta
tttagaaaccttgaagattcaataaagaatcttatgaatgatgacacaattgagaatatt
tttgtctgtggtggtgaatccatatacagggatgctttaaaggataactttgtagataga
atatacttaacaagggtggcactagaagatatagaatttgacacttatttcccagaaata
cctgagacattcttaccagtatatatgtctcagacattctgtactaagaatatctcttat
gattttatggtttttgaaaaacaagaaaaaaaaactttgcaaaattgtgaccctgtaaga
ggtcaattaaagtccatagatgatactgttgatcttcttggtgaaatatttgggattaga
aaaatgggaaatagacacaagtttccaaaagaagaaatctacaacactccaagtattcga
ttcggaagagaacattatgagtttcagtacctagaccttctttctagggtcttagagaat
ggagcttatagagaaaataggacaggcattagtacatattcaatatttgggcagatgatg
agatttgatatgagagaatcttttccacttttgactacaaaaaaagttgcaatcaggtcc
atttttgaggaattaatatggtttattaagggagatactaatggaaatcatttgattgag
aaaaaggtttatatttggtcaggaaatggctcgaaagaatatttggaaagaattggttta
gggcatagagaggagaatgatttgggcccgatctatggttttcagtggagacattacaat
ggagagtacaaaacgatgcatgatgattatactggagttggagttgatcagcttgcaaaa
cttattgagaccttaaagaataacccaaaggatagaagacatatactaacagcctggaat
ccatctgctctatctcaaatggctcttccgccttgccatgtgctttctcagtactatgtt
accaatgataattgtcttagttgtaacctttatcaaaggagttgtgacttgggattagga
tctccatttaacattgcatcctatgccatacttaccatgatgcttgctcaagtttgtggt
tatgaaccaggtgagcttgctatttttattggagatgcccatatctatgaaaatcaccta
acacaattaaaagaacaattaagccgcactccacgtccatttccgcaactcaaattcaag
agaaaagttgaaaatattgaagattttaaatgggaagacatcgaattaatcggatattat
ccatatcccactattaaaatggagatggcggtatag

DBGET integrated database retrieval system