KEGG   Cryptosporidium parvum: cgd4_4460Help
Entry
cgd4_4460         CDS       T00168                                 

Definition
dihydrofolate reductase-thymidylate synthase
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
cpv  Cryptosporidium parvum
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cpv00240]
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cpv00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cpv00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
4
AA seq 531 aa AA seqDB search
IIVVNFRTFKMSKKNVSIVVAASVLSRGIGINGQLPWSISEDLKFFSKITSNNCDSNKKN
ALIMGRKTWDSIGRRPLKNRKIVVISSSLPQDEADPNVIVFRNLEDSIKNLMNDDTIENI
FVCGGESIYRDALKDNFVDRIYLTRVALEDIEFDTYFPEIPETFLPVYMSQTFCTKNISY
DFMVFEKQEKKTLQNCDPVRGQLKSIDDTVDLLGEIFGIRKMGNRHKFPKEEIYNTPSIR
FGREHYEFQYLDLLSRVLENGAYRENRTGISTYSIFGQMMRFDMRESFPLLTTKKVAIRS
IFEELIWFIKGDTNGNHLIEKKVYIWSGNGSKEYLERIGLGHREENDLGPIYGFQWRHYN
GEYKTMHDDYTGVGVDQLAKLIETLKNNPKDRRHILTAWNPSALSQMALPPCHVLSQYYV
TNDNCLSCNLYQRSCDLGLGSPFNIASYAILTMMLAQVCGYEPGELAIFIGDAHIYENHL
TQLKEQLSRTPRPFPQLKFKRKVENIEDFKWEDIELIGYYPYPTIKMEMAV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
attattgttgtgaatttcagaacttttaaaatgagtaaaaagaacgtttcaattgttgtg
gcagcttctgttttgagtagaggaataggaattaacggacaattaccttggtctatatct
gaggatttgaaatttttttcaaagataactagtaataattgtgactcgaataagaagaat
gcactaattatgggaagaaaaacatgggattcaattggaagaagacctcttaaaaataga
aaaattgtcgttatttcctctagcttaccacaagatgaagccgatcctaatgttattgta
tttagaaaccttgaagattcaataaagaatcttatgaatgatgacacaattgagaatatt
tttgtctgtggtggtgaatccatatacagggatgctttaaaggataactttgtagataga
atatacttaacaagggtggcactagaagatatagaatttgacacttatttcccagaaata
cctgagacattcttaccagtatatatgtctcagacattctgtactaagaatatctcttat
gattttatggtttttgaaaaacaagaaaaaaaaactttgcaaaattgtgaccctgtaaga
ggtcaattaaagtccatagatgatactgttgatcttcttggtgaaatatttgggattaga
aaaatgggaaatagacacaagtttccaaaagaagaaatctacaacactccaagtattcga
ttcggaagagaacattatgagtttcagtacctagaccttctttctagggtcttagagaat
ggagcttatagagaaaataggacaggcattagtacatattcaatatttgggcagatgatg
agatttgatatgagagaatcttttccacttttgactacaaaaaaagttgcaatcaggtcc
atttttgaggaattaatatggtttattaagggagatactaatggaaatcatttgattgag
aaaaaggtttatatttggtcaggaaatggctcgaaagaatatttggaaagaattggttta
gggcatagagaggagaatgatttgggcccgatctatggttttcagtggagacattacaat
ggagagtacaaaacgatgcatgatgattatactggagttggagttgatcagcttgcaaaa
cttattgagaccttaaagaataacccaaaggatagaagacatatactaacagcctggaat
ccatctgctctatctcaaatggctcttccgccttgccatgtgctttctcagtactatgtt
accaatgataattgtcttagttgtaacctttatcaaaggagttgtgacttgggattagga
tctccatttaacattgcatcctatgccatacttaccatgatgcttgctcaagtttgtggt
tatgaaccaggtgagcttgctatttttattggagatgcccatatctatgaaaatcaccta
acacaattaaaagaacaattaagccgcactccacgtccatttccgcaactcaaattcaag
agaaaagttgaaaatattgaagattttaaatgggaagacatcgaattaatcggatattat
ccatatcccactattaaaatggagatggcggtatag

DBGET integrated database retrieval system