KEGG   Cryptosporidium parvum: cgd5_3170Help
Entry
cgd5_3170         CDS       T00168                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
cpv  Cryptosporidium parvum
Brite
Exosome [BR:cpv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   cgd5_3170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
5
AA seq 152 aa AA seqDB search
GVDIKWISLQFQLCEKKGQSQSAVLHELGKLSTNSIKMAPKMSSKNNKGAAPKKIHKKKK
ESYSTYIYKVLKQVHPETGISKKSMMIMNSYISDTFEKIAQQAAQLCQTTKKDTIASREI
QTAVRLVLPGELAKHAVSEGTKAVTKFTGGQK
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
ggtgtggatattaagtggatttctctacaatttcaactttgtgaaaaaaaaggacaatca
cagtccgcggttctacacgaattaggaaaattaagcacaaatagtataaaaatggcccca
aaaatgtcttcaaagaacaataaaggtgcagctccaaagaagatccacaagaagaagaag
gagagttactctacatatatctacaaggtattgaagcaagttcatccagaaactggaatc
agtaaaaagtctatgatgattatgaacagttatatctctgacaccttcgagaaaatcgct
cagcaagctgctcagctttgccaaactaccaagaaggatactatcgcatccagagaaatc
caaactgcagtcagacttgttttaccaggtgaactcgcaaagcatgcagtttctgagggt
actaaggctgttaccaagttcactggaggacaaaagtaa

DBGET integrated database retrieval system