KEGG   Cryptosporidium parvum: cgd5_4560Help
Entry
cgd5_4560         CDS       T00168                                 

Definition
tryptophan synthase trpB of possible bacterial origin
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cpv  Cryptosporidium parvum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cpv01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cpv00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cpv00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
5
AA seq 443 aa AA seqDB search
KYFNLFLYFFYFILFYLFHFIFEEKKTIETIFFSYFKIMTDNTYLNNFPDSNGYFGKYGG
KYVPEVINNAMKEIEDAYNKISKSEDFINELKKIRKEFQGRPTPIYYAKNLTKKYGGAEI
YLKREDLNHTGAHKLNHCMGEALLAKYMGKKKLIAETGAGQHGVALATAAAYFGLECEIH
MGEVDVKKEYPNVIRMKILGAKVVCVEFGDKTLKEAVDSAFEAYIKDIDNTFYAIGSVVG
PHPFPKMVRDFQSIVGIESREQFLEMNGDGILPDIVTACVGGGSNAMGIFSGFISDKQVE
LICVEPLGKGNKIGEHAASITYGSEGIMHGFNSIMLKDEEGNPSKVHSIASGLDYPSVGP
EIAYLNSIGRTKTVCITDQEAINGFFELSRTEGIIPAIESSHAIGYVLKIAKEMKGKKIL
INLSGRGDKDLDFVVQNYGYGNN
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
aaatattttaatctatttctatatttcttttattttattttattttatttatttcatttt
atttttgaagaaaaaaaaacaattgaaactatttttttttcttattttaaaataatgaca
gataatacttatttaaataatttcccagattcaaatggttattttggtaaatatggtgga
aaatatgtacctgaagtaattaataatgcaatgaaagaaatagaagatgcttataataaa
ataagtaaaagtgaagattttattaatgaattaaaaaaaataagaaaagaatttcaagga
agaccaacaccaatatattatgcaaaaaatttgacaaaaaaatatggtggtgcagaaata
tatttaaaaagagaagatttaaatcatactggtgcacataaattaaatcattgtatggga
gaagcattattagcaaaatatatgggtaaaaaaaaattaatagcagaaacaggagcagga
caacatggtgtagcattagcaacagcagcagcatattttggtttagaatgtgaaatacat
atgggagaagtagatgtaaaaaaagaatatccaaatgtaattagaatgaaaatattaggt
gcaaaagtagtatgtgtagaatttggtgataaaacattaaaagaagcagtagattcagca
tttgaagcatatataaaagatatagataatacattttatgcaataggttcagtagtagga
ccacatccatttccaaaaatggtacgtgattttcaatcaattgtaggtatagaatcaaga
gaacaatttttagaaatgaatggtgatggtatattaccagatattgttacagcatgtgta
ggtggtggtagtaatgcaatgggtatatttagtggttttatatcagataaacaagtagaa
ttaatttgtgttgaaccattaggtaaaggaaataaaataggtgaacatgcagcaagtata
acatatggtagtgaaggaataatgcatggatttaattcaataatgttaaaagatgaagaa
ggaaatccatcaaaagtacatagtatagcaagtggtttagattatccaagtgtaggtcca
gaaattgcatatttaaatagtattggtcgtacaaaaactgtttgtattacagatcaagaa
gcaattaatggattttttgaattaagtagaacagagggtataataccagcaatagaatca
agtcatgcaattggatatgtattaaaaatagcaaaagaaatgaaaggaaagaaaatttta
ataaatttgagtggtagaggagataaagatttagattttgttgtacaaaattatggatat
ggtaataattaa

DBGET integrated database retrieval system