KEGG   Cryptosporidium parvum: cgd5_4560Help
Entry
cgd5_4560         CDS       T00168                                 

Definition
(RefSeq) tryptophan synthase trpB of possible bacterial origin
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cpv  Cryptosporidium parvum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    cgd5_4560
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cgd5_4560
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    cgd5_4560
Enzymes [BR:cpv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     cgd5_4560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
5
AA seq 443 aa AA seqDB search
KYFNLFLYFFYFILFYLFHFIFEEKKTIETIFFSYFKIMTDNTYLNNFPDSNGYFGKYGG
KYVPEVINNAMKEIEDAYNKISKSEDFINELKKIRKEFQGRPTPIYYAKNLTKKYGGAEI
YLKREDLNHTGAHKLNHCMGEALLAKYMGKKKLIAETGAGQHGVALATAAAYFGLECEIH
MGEVDVKKEYPNVIRMKILGAKVVCVEFGDKTLKEAVDSAFEAYIKDIDNTFYAIGSVVG
PHPFPKMVRDFQSIVGIESREQFLEMNGDGILPDIVTACVGGGSNAMGIFSGFISDKQVE
LICVEPLGKGNKIGEHAASITYGSEGIMHGFNSIMLKDEEGNPSKVHSIASGLDYPSVGP
EIAYLNSIGRTKTVCITDQEAINGFFELSRTEGIIPAIESSHAIGYVLKIAKEMKGKKIL
INLSGRGDKDLDFVVQNYGYGNN
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
aaatattttaatctatttctatatttcttttattttattttattttatttatttcatttt
atttttgaagaaaaaaaaacaattgaaactatttttttttcttattttaaaataatgaca
gataatacttatttaaataatttcccagattcaaatggttattttggtaaatatggtgga
aaatatgtacctgaagtaattaataatgcaatgaaagaaatagaagatgcttataataaa
ataagtaaaagtgaagattttattaatgaattaaaaaaaataagaaaagaatttcaagga
agaccaacaccaatatattatgcaaaaaatttgacaaaaaaatatggtggtgcagaaata
tatttaaaaagagaagatttaaatcatactggtgcacataaattaaatcattgtatggga
gaagcattattagcaaaatatatgggtaaaaaaaaattaatagcagaaacaggagcagga
caacatggtgtagcattagcaacagcagcagcatattttggtttagaatgtgaaatacat
atgggagaagtagatgtaaaaaaagaatatccaaatgtaattagaatgaaaatattaggt
gcaaaagtagtatgtgtagaatttggtgataaaacattaaaagaagcagtagattcagca
tttgaagcatatataaaagatatagataatacattttatgcaataggttcagtagtagga
ccacatccatttccaaaaatggtacgtgattttcaatcaattgtaggtatagaatcaaga
gaacaatttttagaaatgaatggtgatggtatattaccagatattgttacagcatgtgta
ggtggtggtagtaatgcaatgggtatatttagtggttttatatcagataaacaagtagaa
ttaatttgtgttgaaccattaggtaaaggaaataaaataggtgaacatgcagcaagtata
acatatggtagtgaaggaataatgcatggatttaattcaataatgttaaaagatgaagaa
ggaaatccatcaaaagtacatagtatagcaagtggtttagattatccaagtgtaggtcca
gaaattgcatatttaaatagtattggtcgtacaaaaactgtttgtattacagatcaagaa
gcaattaatggattttttgaattaagtagaacagagggtataataccagcaatagaatca
agtcatgcaattggatatgtattaaaaatagcaaaagaaatgaaaggaaagaaaatttta
ataaatttgagtggtagaggagataaagatttagattttgttgtacaaaattatggatat
ggtaataattaa

DBGET integrated database retrieval system