KEGG   Cryptosporidium parvum: cgd6_1020Help
Entry
cgd6_1020         CDS       T00168                                 

Definition
translation initiation factor if-4E
Orthology
K03259  
translation initiation factor 4E
Organism
cpv  Cryptosporidium parvum
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    cgd6_1020
Translation factors [BR:cpv03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    cgd6_1020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
6
AA seq 240 aa AA seqDB search
MTEKEVVSKYLSFNESIEPNLTLPTACSEVDLPEDLISRPLPLSHEWIVWEQLNVETRKD
LDYSNATKPVARFSSVQQFWWLWHNIPQPSELLKGKRMIRESSDGSKSVVDAVILFKEGI
QPMWEDPMNATGGHIHFRAWQSSVVPGELDTMWNNLVLAVIGGSLENSSIVNGIRLVDKL
GGNKGNIRVEIWFSDFSNQSAHQALLKEIETLMSSLLDGTSCEPPHFEVKSHSKSKPDAN
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaaagaagtagtttcaaagtatttgtcctttaatgagtccatagagccaaac
ttgacacttccaacggcctgtagtgaagttgatttaccagaggatttaatatctaggcca
ttaccattatctcatgaatggattgtatgggaacaattaaatgtggagacaagaaaagat
ttagactactcaaatgcaacaaagccagttgccaggttttcatctgttcaacagttttgg
tggctatggcataatattcctcagccttctgagttattaaagggaaaaagaatgattaga
gaatcatcagatggttcaaagagtgtagtagacgcagtgattttatttaaagaaggtatc
caaccaatgtgggaagatccaatgaatgcaactggtggtcatattcactttagagcttgg
caatcatcagttgttcctggagaattagatacaatgtggaataatttggttttggctgtg
ataggaggaagtttggagaactcttctatagttaatggaattagattggttgataaactt
ggaggtaataagggtaatattagagttgagatatggttttcagatttttcaaatcaatca
gcccatcaagcacttcttaaggaaattgagactttaatgagtagcttattggatggtaca
tcttgtgagcctcctcattttgaagttaaatcgcattcaaagtcaaaacccgatgcaaat
taa

DBGET integrated database retrieval system