KEGG   Cryptosporidium parvum: cgd6_120Help
Entry
cgd6_120          CDS       T00168                                 

Definition
disulfide-isomerase, signal peptide plus ER retention motif ER protein
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
cpv  Cryptosporidium parvum
Brite
Enzymes [BR:cpv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     cgd6_120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
6
AA seq 481 aa AA seqDB search
MIGIRSLVSAAFLGFSCLSKVVLGGDEAHFISEHITSLTSSNFEDFIKSKEHVIVTFFAP
WCGHCTALEPEFKATCAEISKLSPPVHCGSVDATENMELAQQYGVSGYPTIKFFSGIDSV
QNYSGARSKDAFIKYIKKLTGPAVQVAESEEAIKTIFASSSSAFVGRFTSKDSAEYAVFE
KVASGHREHNYAFIAFFQEGEQKLEVLHKDEEPVSLPMPKTVEELEAKISIMNVPLFSAI
SAENYSLYMSREGYTAWFCGTNEDFAKYASNIRKVAADYREKYAFVFLDTEQFGSHATQH
LLIEKFPGLVIQSVNVPSIRYMYGPAKFDSVEPLKEFMKQVSEGKHELSIKSEPIPAEQS
GPVTVVVGKTFEEIVFRSDKDVLLEIYAQWCGHCKNLEPIYNQLGEEYKDNDKVVIAKIN
GPQNDIPYEGFSPRAFPTILFVKAGTRTPIPYDGKRTVEAFKEFISEHSSFPQEKESRDE
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgatcggaattagaagcttggtttcagcagcatttttaggtttttcttgtctctccaag
gtagtcttgggtggagatgaagctcacttcatttcagaacacattacttccttaacttcc
tccaacttcgaagacttcattaagagcaaggaacacgtaattgttactttctttgcccca
tggtgcggccattgtactgctttagagccagaattcaaggcaacatgcgctgaaatctca
aagctctctcccccagtacactgtggcagtgttgatgcaactgaaaatatggagcttgca
caacaatatggtgtgagcggatacccaaccatcaaattcttcagtggtattgacagtgtt
cagaactattcaggagcaagaagcaaggatgcattcatcaagtatattaagaagttgacc
ggaccagcagtccaagttgctgaatcagaagaagctatcaagacaatcttcgcttcttct
tcttcagcctttgttggaagattcacctctaaggactcagctgagtatgctgtcttcgag
aaggttgctagtggtcaccgcgagcacaactatgctttcattgctttcttccaagaaggt
gaacaaaagctcgaggtattacacaaggacgaggagccagtttctctcccaatgccaaag
actgttgaagagttggaggccaagatatccataatgaatgtaccattgttctctgcaatt
agtgctgagaactactccctctatatgtcaagagaaggttatactgcctggttctgtggt
actaacgaggacttcgccaagtatgcttcaaacattagaaaggttgcagctgattacaga
gaaaagtatgcctttgttttccttgatactgagcaatttggttcccatgctactcaacat
ctcttaattgagaaattcccaggtttggttatccaaagtgtcaatgttccatcaattaga
tacatgtatggtccagctaaattcgactctgttgagccattaaaggaatttatgaagcaa
gtttctgaaggcaagcacgaactcagcattaagtctgagccaatcccagctgagcaatct
ggtccagtcactgttgttgttggtaagaccttcgaagaaattgttttcagaagtgacaag
gatgttcttttggaaatctatgcccaatggtgtggacactgtaagaacctcgagccaatc
tacaaccaactcggcgaagagtacaaggacaacgacaaggttgtgattgcaaagatcaat
ggaccacaaaacgatatcccatatgaaggtttcagtccaagagccttcccaactatcttg
ttcgtcaaggccggaactagaaccccaattccttatgatggaaagagaactgttgaggcc
ttcaaggaattcatcagtgaacattcttccttccctcaagaaaaggaatctcgtgacgaa
ctctaa

DBGET integrated database retrieval system